BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00412X (394 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41016| Best HMM Match : RPEL (HMM E-Value=8.9) 40 0.001 SB_39882| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_28599| Best HMM Match : MSSP (HMM E-Value=6.8) 40 0.001 SB_10424| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_52707| Best HMM Match : RPEL (HMM E-Value=8.9) 40 0.001 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 40 0.001 SB_30254| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_8500| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_45856| Best HMM Match : DUF755 (HMM E-Value=4.7) 35 0.027 SB_12256| Best HMM Match : TP1 (HMM E-Value=8.5) 35 0.027 SB_25877| Best HMM Match : TP1 (HMM E-Value=8.5) 31 0.33 SB_46955| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.33 SB_53052| Best HMM Match : U79_P34 (HMM E-Value=2.7) 29 1.0 SB_29775| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.3 SB_45246| Best HMM Match : zf-MYND (HMM E-Value=0.19) 27 4.1 SB_42721| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.1 SB_55199| Best HMM Match : PKD (HMM E-Value=0.75) 27 4.1 SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.1 SB_31308| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.5 >SB_41016| Best HMM Match : RPEL (HMM E-Value=8.9) Length = 148 Score = 39.5 bits (88), Expect = 0.001 Identities = 19/37 (51%), Positives = 24/37 (64%) Frame = +2 Query: 263 ESGCLRVQP*AGGKLHXXLNMTARPIQRRRPKFIIKS 373 ESGCL +QP GGKLH LN+ RPI + + +KS Sbjct: 59 ESGCLGMQPKMGGKLHLKLNIGTRPIANKYREGKMKS 95 >SB_39882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 39.5 bits (88), Expect = 0.001 Identities = 19/37 (51%), Positives = 24/37 (64%) Frame = +2 Query: 263 ESGCLRVQP*AGGKLHXXLNMTARPIQRRRPKFIIKS 373 ESGCL +QP GGKLH LN+ RPI + + +KS Sbjct: 5 ESGCLGMQPKMGGKLHLKLNIGTRPIANKYREGKMKS 41 >SB_28599| Best HMM Match : MSSP (HMM E-Value=6.8) Length = 148 Score = 39.5 bits (88), Expect = 0.001 Identities = 19/37 (51%), Positives = 24/37 (64%) Frame = +2 Query: 263 ESGCLRVQP*AGGKLHXXLNMTARPIQRRRPKFIIKS 373 ESGCL +QP GGKLH LN+ RPI + + +KS Sbjct: 59 ESGCLGMQPKMGGKLHLKLNIGTRPIANKYREGKMKS 95 >SB_10424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 39.5 bits (88), Expect = 0.001 Identities = 19/37 (51%), Positives = 24/37 (64%) Frame = +2 Query: 263 ESGCLRVQP*AGGKLHXXLNMTARPIQRRRPKFIIKS 373 ESGCL +QP GGKLH LN+ RPI + + +KS Sbjct: 33 ESGCLGMQPKMGGKLHLKLNIGTRPIANKYREGKMKS 69 >SB_52707| Best HMM Match : RPEL (HMM E-Value=8.9) Length = 147 Score = 39.5 bits (88), Expect = 0.001 Identities = 19/37 (51%), Positives = 24/37 (64%) Frame = +2 Query: 263 ESGCLRVQP*AGGKLHXXLNMTARPIQRRRPKFIIKS 373 ESGCL +QP GGKLH LN+ RPI + + +KS Sbjct: 58 ESGCLGMQPKMGGKLHLKLNIGTRPIANKYREGKMKS 94 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 39.5 bits (88), Expect = 0.001 Identities = 19/37 (51%), Positives = 24/37 (64%) Frame = +2 Query: 263 ESGCLRVQP*AGGKLHXXLNMTARPIQRRRPKFIIKS 373 ESGCL +QP GGKLH LN+ RPI + + +KS Sbjct: 117 ESGCLGMQPKMGGKLHLKLNIGTRPIANKYREGKMKS 153 >SB_30254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 39.5 bits (88), Expect = 0.001 Identities = 19/37 (51%), Positives = 24/37 (64%) Frame = +2 Query: 263 ESGCLRVQP*AGGKLHXXLNMTARPIQRRRPKFIIKS 373 ESGCL +QP GGKLH LN+ RPI + + +KS Sbjct: 16 ESGCLGMQPKMGGKLHLKLNIGTRPIANKYREGKMKS 52 >SB_8500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3408 Score = 39.5 bits (88), Expect = 0.001 Identities = 19/37 (51%), Positives = 24/37 (64%) Frame = +2 Query: 263 ESGCLRVQP*AGGKLHXXLNMTARPIQRRRPKFIIKS 373 ESGCL +QP GGKLH LN+ RPI + + +KS Sbjct: 722 ESGCLGMQPKMGGKLHLKLNIGTRPIANKYREGKMKS 758 >SB_45856| Best HMM Match : DUF755 (HMM E-Value=4.7) Length = 187 Score = 34.7 bits (76), Expect = 0.027 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -2 Query: 324 IFSX*WSLPPA*GCTLKQPDSKE 256 IFS WSLPP GC KQPDS + Sbjct: 106 IFSFRWSLPPILGCIPKQPDSSK 128 >SB_12256| Best HMM Match : TP1 (HMM E-Value=8.5) Length = 156 Score = 34.7 bits (76), Expect = 0.027 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -2 Query: 324 IFSX*WSLPPA*GCTLKQPDSKE 256 IFS WSLPP GC KQPDS + Sbjct: 75 IFSFRWSLPPILGCIPKQPDSSK 97 >SB_25877| Best HMM Match : TP1 (HMM E-Value=8.5) Length = 139 Score = 31.1 bits (67), Expect = 0.33 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 309 WSLPPA*GCTLKQPDSKE 256 WSLPP GC KQPDS + Sbjct: 63 WSLPPILGCIPKQPDSSK 80 >SB_46955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 31.1 bits (67), Expect = 0.33 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 309 WSLPPA*GCTLKQPDSKE 256 WSLPP GC KQPDS + Sbjct: 36 WSLPPILGCIPKQPDSSK 53 >SB_53052| Best HMM Match : U79_P34 (HMM E-Value=2.7) Length = 1130 Score = 29.5 bits (63), Expect = 1.0 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = -1 Query: 295 RLGLH--SQATRL*GAPSRRDPPSLRAWHPLRENG 197 RLG+H S AT + PSRR PPS+ H +R+ G Sbjct: 713 RLGVHKHSVATHVEADPSRRRPPSVHRCH-IRKGG 746 >SB_29775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 547 Score = 28.3 bits (60), Expect = 2.3 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -1 Query: 310 MEFTTRLGLH--SQATRL*GAPSRRDPPSLRAWH 215 + F RLG+H S T + PSRR PPS+ H Sbjct: 237 VRFGLRLGVHKHSVVTHVEADPSRRRPPSVHRCH 270 >SB_45246| Best HMM Match : zf-MYND (HMM E-Value=0.19) Length = 1828 Score = 27.5 bits (58), Expect = 4.1 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = -2 Query: 189 KTNLDRSRRDEKAEPPEHHISRYRLKQRDSV-LGYIPVRSPLLRKSWLVSFPP 34 KT S + P +RYR++ RDSV ++ R+P S L++F P Sbjct: 364 KTANATSSATNTTDLPRRRGTRYRIRARDSVDKSFVKFRNPNPSFSGLLTFEP 416 >SB_42721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 564 Score = 27.5 bits (58), Expect = 4.1 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 2/25 (8%) Frame = -1 Query: 295 RLGLHSQ--ATRL*GAPSRRDPPSL 227 RLG+H Q AT + PSRR PPS+ Sbjct: 440 RLGVHKQNVATHVEADPSRRRPPSV 464 >SB_55199| Best HMM Match : PKD (HMM E-Value=0.75) Length = 462 Score = 27.5 bits (58), Expect = 4.1 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -1 Query: 310 MEFTTRLGLHSQATRL*GAPSRRDPPSLRAWHPLREN 200 ++ T+ + + S T+ P RR ++RAWH RE+ Sbjct: 411 VQATSEVTVASVETQTDAVPERRPHRAVRAWHRFRES 447 >SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 4.1 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -1 Query: 310 MEFTTRLGLHSQAT 269 MEFTT GLHSQ T Sbjct: 1 MEFTTHFGLHSQTT 14 >SB_31308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 368 Score = 26.2 bits (55), Expect = 9.5 Identities = 14/48 (29%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = -2 Query: 276 KQPDSKELPLAA-TLRRYGPGTLYGKTAPFKTNLDRSRRDEKAEPPEH 136 K+P + + L T+ R+GPGT+ N+ R PP H Sbjct: 262 KRPRHRHISLCQETITRHGPGTITTPPRHVPDNITRHGPGTITTPPRH 309 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,750,483 Number of Sequences: 59808 Number of extensions: 200780 Number of successful extensions: 519 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 489 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 519 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 678472135 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -