BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00410 (468 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC084158-29|AAL27264.2| 666|Caenorhabditis elegans Yeast smf (d... 30 0.95 >AC084158-29|AAL27264.2| 666|Caenorhabditis elegans Yeast smf (divalent cation transporter)homolog protein 3 protein. Length = 666 Score = 29.9 bits (64), Expect = 0.95 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = -1 Query: 468 FFFFFFELSTKYFIDFQFYNIT-FITKKTLADINFKLYLKLNVLLI 334 FF FF T F+ F F +T FI+K T+ +NF +++ N L++ Sbjct: 48 FFKIFFADKTMNFLIFIFDALTFFISKNTVDTVNFAIFVP-NFLIV 92 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,895,124 Number of Sequences: 27780 Number of extensions: 156018 Number of successful extensions: 396 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 392 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 396 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 839684522 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -