Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS00410
         (468 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g05580.1 68416.m00619 serine/threonine protein phosphatase, p...    27   6.3  

>At3g05580.1 68416.m00619 serine/threonine protein phosphatase,
           putative similar to serine/threonine protein phosphatase
           PP1 isozyme 8 SP:O82734 from [Arabidopsis thaliana]
          Length = 318

 Score = 27.1 bits (57), Expect = 6.3
 Identities = 13/39 (33%), Positives = 20/39 (51%)
 Frame = +2

Query: 62  NFAKILSFDFALVLTLSMTSAAPEPRWKIFKKIEKMGRN 178
           N   +LS D +LV +  +   AP       KK+ KMG++
Sbjct: 280 NAGALLSVDQSLVCSFEILKPAPASSTNPLKKVPKMGKS 318


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,116,067
Number of Sequences: 28952
Number of extensions: 137476
Number of successful extensions: 293
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 286
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 292
length of database: 12,070,560
effective HSP length: 75
effective length of database: 9,899,160
effective search space used: 791932800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)