BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00399 (435 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC029819-1|AAH29819.1| 483|Homo sapiens dual oxidase maturation... 29 5.2 >BC029819-1|AAH29819.1| 483|Homo sapiens dual oxidase maturation factor 1 protein. Length = 483 Score = 29.5 bits (63), Expect = 5.2 Identities = 27/90 (30%), Positives = 39/90 (43%), Gaps = 2/90 (2%) Frame = +2 Query: 62 EQKLKEHGASSCISGKRGRRCCNIWHWGSVD-SISGSRARF-QLSGNSGRKHSRCCTSIL 235 E++ EH S RGR +W WGS + G RA +L NSG K C + Sbjct: 396 EERWAEHTGDSP-RPLRGRGTGRLWRWGSKERRACGVRAMLPRLVSNSGLKRP-SCLDLP 453 Query: 236 RKFSGRRIVSQLTAAAMVAPTP*GDAKHHP 325 + + RR ++ PTP ++H P Sbjct: 454 KCWDYRR--DARAFFHLLEPTPCVTSRHTP 481 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 59,703,178 Number of Sequences: 237096 Number of extensions: 1175073 Number of successful extensions: 2030 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1974 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2025 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3487985734 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -