BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00399 (435 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g16141.1 68417.m02446 expressed protein contains 1 predicted ... 33 0.11 At4g15840.1 68417.m02409 expressed protein 29 1.0 At2g21300.1 68415.m02535 kinesin motor family protein contains P... 27 4.1 At5g07790.1 68418.m00892 expressed protein 27 5.5 At4g03610.1 68417.m00496 phosphonate metabolism protein-related ... 27 5.5 >At4g16141.1 68417.m02446 expressed protein contains 1 predicted transmembrane domain; contains a partial Pfam PF00320: GATA zinc finger profile Length = 226 Score = 32.7 bits (71), Expect = 0.11 Identities = 18/40 (45%), Positives = 21/40 (52%) Frame = -1 Query: 363 KTEKVRSWSDVENG*CLASPHGVGATMAAAVNCDTMRRPL 244 K E SDV+NG C +S G G T V+C T R PL Sbjct: 11 KLESAGDSSDVDNGNCSSSGSG-GDTKKTCVDCGTSRTPL 49 >At4g15840.1 68417.m02409 expressed protein Length = 660 Score = 29.5 bits (63), Expect = 1.0 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 158 ISGSRARFQLSGNSGRKHSRCCTSILRKFSG 250 +SGS FQ S NS R CTS++ K G Sbjct: 115 VSGSNLVFQQSSNSQTNFGRPCTSVVDKTEG 145 >At2g21300.1 68415.m02535 kinesin motor family protein contains Pfam profile: kinesin motor domain PF00225 Length = 862 Score = 27.5 bits (58), Expect = 4.1 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 Query: 68 KLKEHGASSCISGKRGRRCCNIWHWGSVDSISG 166 K+ EH ASS R N W GSV ISG Sbjct: 425 KMVEHDASSKAGTPHFRNRTNKWEDGSVSEISG 457 >At5g07790.1 68418.m00892 expressed protein Length = 616 Score = 27.1 bits (57), Expect = 5.5 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +2 Query: 89 SSCISGKRGRRCCNIWHWGSVDSISGSRARFQLSGNSGRKHSRCCTSI 232 S + KR RR + G+ +S + A +S SGR+ + C TS+ Sbjct: 411 SGRVKRKRSRRISLVAE-GNYQQVSAAEAIVDISRKSGRETAACITSL 457 >At4g03610.1 68417.m00496 phosphonate metabolism protein-related weak similarity to PhnP protein. (Swiss-Prot:P16692) [Escherichia coli] Length = 290 Score = 27.1 bits (57), Expect = 5.5 Identities = 14/53 (26%), Positives = 24/53 (45%), Gaps = 4/53 (7%) Frame = -1 Query: 162 LMESTDPQCHILQHRRPRLPLMQLEAPCS----FNFCSLRAIRRYKSYYVD*G 16 L++ +DP CH+ LP + C+ ++CS R+K +D G Sbjct: 30 LLQPSDPPCHVCSQSLSLLPHLNPNYRCNTSLLIDYCSKEEDGRHKYILIDVG 82 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,671,070 Number of Sequences: 28952 Number of extensions: 160905 Number of successful extensions: 361 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 358 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 361 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 683042040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -