BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00397 (789 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 26 1.5 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 26 1.5 AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phospho... 24 6.2 AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 24 6.2 AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 24 6.2 AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 23 8.1 AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. 23 8.1 AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. 23 8.1 AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. 23 8.1 AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein p... 23 8.1 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 23 8.1 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 25.8 bits (54), Expect = 1.5 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 387 QRYPQRFRYREVHQQGEQDHHYQRQR 464 QR PQR+ QQ +Q H Q+Q+ Sbjct: 354 QRQPQRYVVAGSSQQQQQQHQQQQQK 379 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 25.8 bits (54), Expect = 1.5 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +3 Query: 372 LRHRCQRYPQRFRYREVHQQGEQDHHYQRQRS 467 L+ + Q+ Q+ + + HQQ + HH+Q Q S Sbjct: 1308 LQQQQQQQQQQQQQHQQHQQHQLQHHHQPQLS 1339 >AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phosphoribosyltransferase-like protein protein. Length = 519 Score = 23.8 bits (49), Expect = 6.2 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +1 Query: 343 PRGVPQIEVTFDIDANGILNVSAIEKSTNKE--NKITITNDKGRLS 474 P G + T+D+ +G+LN A+ N + I I D G L+ Sbjct: 255 PDGFMALVDTYDVKRSGLLNFCAVALGLNDQGYRAIGIRIDSGDLA 300 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 23.8 bits (49), Expect = 6.2 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = -3 Query: 256 VSGLVIRVGGECLSLFSGDGSVTLDECGHDTSS 158 V+G+V+ +GG C L D ++ + G D+++ Sbjct: 47 VAGIVLGMGGNCKLLSRCDNVISYIKNGKDSAT 79 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 23.8 bits (49), Expect = 6.2 Identities = 15/62 (24%), Positives = 31/62 (50%), Gaps = 3/62 (4%) Frame = +1 Query: 343 PRGVPQIEVTFDIDANGILNVSAIEK---STNKENKITITNDKGRLSKEEIERMVNEAGS 513 P+G + ++ + ++GIL ++ K N+E I IT+ G+ K+ + E G Sbjct: 65 PKGHNEADIVSSLSSDGILTITCPRKEIEQKNEERSIPITH-TGQPMKQVTGKAAPENGH 123 Query: 514 TE 519 ++ Sbjct: 124 SK 125 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 23.4 bits (48), Expect = 8.1 Identities = 15/57 (26%), Positives = 25/57 (43%), Gaps = 1/57 (1%) Frame = +1 Query: 376 DIDANGILNVSAIEKSTNKENKITITNDKGRLSK-EEIERMVNEAGSTETRMTSKRR 543 D +AN + S++EK K N + N + + EE E + G +R + R Sbjct: 150 DAEANAPGSGSSLEKKKKKPNSLNAANGQSVAGRGEEAEGRMAPGGGGASRTSEYSR 206 >AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +3 Query: 387 QRYPQRFRYREVHQQGEQDHHYQRQRSSL 473 QR PQ+F+ ++ Q Q QRQ+ L Sbjct: 189 QRQPQQFQQQQRQPQYLQPQQAQRQQEEL 217 >AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +3 Query: 387 QRYPQRFRYREVHQQGEQDHHYQRQRSSL 473 QR PQ+F+ ++ Q Q QRQ+ L Sbjct: 189 QRQPQQFQQQQRQPQYLQPQQAQRQQEEL 217 >AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +3 Query: 387 QRYPQRFRYREVHQQGEQDHHYQRQRSSL 473 QR PQ+F+ ++ Q Q QRQ+ L Sbjct: 188 QRQPQQFQQQQRQPQYLQPQQSQRQQEEL 216 >AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein protein. Length = 357 Score = 23.4 bits (48), Expect = 8.1 Identities = 9/35 (25%), Positives = 18/35 (51%) Frame = +1 Query: 451 TNDKGRLSKEEIERMVNEAGSTETRMTSKRRPSRP 555 T + R ++ ++E + + M +KR+P RP Sbjct: 313 TVTRKRTTESDVESDASSSSMNSFTMVAKRKPGRP 347 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 23.4 bits (48), Expect = 8.1 Identities = 17/122 (13%), Positives = 52/122 (42%), Gaps = 1/122 (0%) Frame = +3 Query: 408 RYREVHQQGEQDHHYQRQRSS-LQGRDRAYG**GRKYRNEDDKQKETIQAKNALESYCFS 584 R ++ HQQ +Q QRQ+ Q R + ++ + + +Q++ Q + + + Sbjct: 306 RQQQQHQQQQQQQQQQRQQQQRQQQRQQQQRQQQQQQQQQQRQQQQRQQQQQQQQQHQQQ 365 Query: 585 MKSTMEDEKLKEKISDSDKQTILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIIR 764 + + ++ +++ S + + + Q + + + +Q+ + ++ ++R Sbjct: 366 QQQWQQQQQQQQQPRQSLPHRKQTQLQLSPRLQQQQQQQQQSQQQQQQQPQQLLWTTVVR 425 Query: 765 RC 770 C Sbjct: 426 SC 427 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 751,915 Number of Sequences: 2352 Number of extensions: 15337 Number of successful extensions: 61 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82744797 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -