BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00395 (336 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g20730.3 68418.m02464 auxin-responsive factor (ARF7) identica... 26 5.4 At5g20730.2 68418.m02463 auxin-responsive factor (ARF7) identica... 26 5.4 At5g20730.1 68418.m02462 auxin-responsive factor (ARF7) identica... 26 5.4 At2g42270.1 68415.m05232 U5 small nuclear ribonucleoprotein heli... 25 9.5 At1g71680.1 68414.m08271 lysine and histidine specific transport... 25 9.5 >At5g20730.3 68418.m02464 auxin-responsive factor (ARF7) identical to auxin response factor 7 GI:4104929 from [Arabidopsis thaliana] Length = 1150 Score = 26.2 bits (55), Expect = 5.4 Identities = 17/43 (39%), Positives = 24/43 (55%) Frame = -2 Query: 185 QTXLLEQGVLQKQELQRVQQVGRYLQPMKPLAPVFHSSLHGQE 57 Q LLEQ +Q Q LQR+QQ + Q + P + + H L Q+ Sbjct: 741 QQSLLEQPHIQFQLLQRLQQ-QQQQQFLSPQSQLPHHQLQSQQ 782 >At5g20730.2 68418.m02463 auxin-responsive factor (ARF7) identical to auxin response factor 7 GI:4104929 from [Arabidopsis thaliana] Length = 1164 Score = 26.2 bits (55), Expect = 5.4 Identities = 17/43 (39%), Positives = 24/43 (55%) Frame = -2 Query: 185 QTXLLEQGVLQKQELQRVQQVGRYLQPMKPLAPVFHSSLHGQE 57 Q LLEQ +Q Q LQR+QQ + Q + P + + H L Q+ Sbjct: 740 QQSLLEQPHIQFQLLQRLQQ-QQQQQFLSPQSQLPHHQLQSQQ 781 >At5g20730.1 68418.m02462 auxin-responsive factor (ARF7) identical to auxin response factor 7 GI:4104929 from [Arabidopsis thaliana] Length = 1165 Score = 26.2 bits (55), Expect = 5.4 Identities = 17/43 (39%), Positives = 24/43 (55%) Frame = -2 Query: 185 QTXLLEQGVLQKQELQRVQQVGRYLQPMKPLAPVFHSSLHGQE 57 Q LLEQ +Q Q LQR+QQ + Q + P + + H L Q+ Sbjct: 741 QQSLLEQPHIQFQLLQRLQQ-QQQQQFLSPQSQLPHHQLQSQQ 782 >At2g42270.1 68415.m05232 U5 small nuclear ribonucleoprotein helicase, putative Length = 2172 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 24 RLWYQLNQK*LLLSMKTGMKHWS 92 R W QL+QK L LS G + WS Sbjct: 1127 RGWAQLSQKALNLSKMVGKRMWS 1149 >At1g71680.1 68414.m08271 lysine and histidine specific transporter, putative similar to lysine and histidine specific transporter GB: AAC49885 GI:2576361 from (Arabidopsis thaliana); contains Pfam profile PF01490: Transmembrane amino acid transporter protein Length = 434 Score = 25.4 bits (53), Expect = 9.5 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 4/37 (10%) Frame = -3 Query: 115 IFSP*SHWLQCFIPVFMDR----SNYFWFSWYHSLFL 17 +FS S++L C I + M R S ++W SW FL Sbjct: 388 VFSSTSYFLPCIIWLIMKRPKRFSAHWWCSWVSLSFL 424 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,325,481 Number of Sequences: 28952 Number of extensions: 68126 Number of successful extensions: 151 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 149 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 151 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 389454624 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -