BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00394 (712 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0410 + 2928382-2930973 29 4.8 02_05_1113 + 34207997-34208380 29 4.8 03_06_0754 - 36025579-36027000 28 6.4 >06_01_0410 + 2928382-2930973 Length = 863 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +3 Query: 210 NQQPLVQLGYGRRLHNAVKTVRSLVDNQGSDVCRDVVSRLVSQGIK 347 N L +LG G + ++K LVD+ G D+ D + L+ K Sbjct: 279 NHVDLAKLGMGTTIECSMKGKNQLVDDDGKDMANDERTELIEVDTK 324 >02_05_1113 + 34207997-34208380 Length = 127 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +3 Query: 129 WSRVRTARRLEDPDGIQHEDGLCRRNVNQQP 221 W R RTARR DG E+G C R + P Sbjct: 45 WRRSRTARRTPVADGDGSEEGGCGRGRRRGP 75 >03_06_0754 - 36025579-36027000 Length = 473 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 541 RLHQPPCQLATHLSLGRQQRDIQDTEHRIRDVLETGRER 657 R H+ Q+A +L D+ D EH +R +L+T R Sbjct: 145 RAHKMDKQVAATSALRTAMEDLADAEHGLRKLLQTSSSR 183 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,831,927 Number of Sequences: 37544 Number of extensions: 348596 Number of successful extensions: 948 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 925 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 948 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1839213168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -