BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00391 (642 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0723 - 26688378-26688385,26689351-26689569,26690100-266901... 28 7.2 >11_06_0723 - 26688378-26688385,26689351-26689569,26690100-26690106, 26690194-26690256,26690329-26690400,26690507-26691681, 26692024-26692626,26692643-26692781 Length = 761 Score = 27.9 bits (59), Expect = 7.2 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 423 YLFHIKMHFSLF*LDRTHTC*PSCHRHTGCHTDTDKQ 533 YL K S LD H PS RH CH D Q Sbjct: 117 YLHDEKFCISTLTLDHNHVVSPSKARHLRCHKKLDLQ 153 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,561,995 Number of Sequences: 37544 Number of extensions: 259188 Number of successful extensions: 399 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 396 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 399 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1584867848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -