BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00390 (787 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. 28 0.28 AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 27 0.66 AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. 25 3.5 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 24 4.6 >DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. Length = 409 Score = 28.3 bits (60), Expect = 0.28 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = -1 Query: 448 LGLYRHSVDDDHADALVNDSRNVSGAVRNDGRAHERHYFDRVI 320 L L + D +A+ N R +S ++ND H R Y+ +++ Sbjct: 64 LTLIYEASDTSFGNAVSNTKRELSSVIQNDNIDHTRSYYKQLL 106 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 27.1 bits (57), Expect = 0.66 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +1 Query: 244 PTRVQDPQQDPGARRERLRHPGLHQG*LGQNSDAHERAHHSEQRQR 381 P + Q PQQ + R + HQG ++AH +QRQ+ Sbjct: 260 PQQQQQPQQKQQQLQRRQQQQQQHQGQRYVPPQLRQQAHQQQQRQQ 305 >AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 24.6 bits (51), Expect = 3.5 Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 3/42 (7%) Frame = +2 Query: 14 GPIRQAPQLRDQRGPEVSVLRPAVHRA---VQAAQAPLYWRA 130 GP++Q Q + Q GP +P V A + ++P Y R+ Sbjct: 19 GPLQQQQQQQQQHGPSGPQYQPGVPLAPYPTETQRSPAYGRS 60 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 24.2 bits (50), Expect = 4.6 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = +2 Query: 602 CRPGTTTRQ*LSRSPCKMITSVLLSRSWSTDSC 700 CRP TT + ++T+ SW D+C Sbjct: 16 CRPTTTNNDDCLQEQRTLLTTPTEGGSWHNDTC 48 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 783,119 Number of Sequences: 2352 Number of extensions: 17089 Number of successful extensions: 37 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82328994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -