BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00377 (730 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_1023 + 8840754-8842988,8843189-8843362 33 0.31 01_07_0205 - 41978437-41980599,41980805-41981215 29 3.8 01_01_0778 + 6024154-6024315,6024725-6024802,6024909-6025071,602... 28 6.6 >07_01_1023 + 8840754-8842988,8843189-8843362 Length = 802 Score = 32.7 bits (71), Expect = 0.31 Identities = 19/64 (29%), Positives = 32/64 (50%) Frame = +2 Query: 116 PNEPLITPKGENNSVFQLTEQFLTEDYANNGIELNNRFGDDASEKIPSRTSANFQNLKLQ 295 P++ ++ K +NN L + + ANN L+ RF +DA+ IP+R ++ Q Sbjct: 481 PSKVVLPKKSKNNQRRNLVTTAVKCEEANND-PLSRRFSEDANRNIPTRNLSDKTKNNAQ 539 Query: 296 LNYP 307 N P Sbjct: 540 SNRP 543 >01_07_0205 - 41978437-41980599,41980805-41981215 Length = 857 Score = 29.1 bits (62), Expect = 3.8 Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = -1 Query: 190 LSQKLFCELKHRIV-FALGCDERLIWTIE 107 L +L+CEL +V +A C+ER +W IE Sbjct: 311 LRSRLYCELDDWLVSWADACEERSVWRIE 339 >01_01_0778 + 6024154-6024315,6024725-6024802,6024909-6025071, 6025484-6025788,6025897-6025961,6026570-6026763, 6027233-6027441,6028147-6028325,6029345-6029459, 6029520-6029558 Length = 502 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +1 Query: 418 CAFARVNLNPQLFNYCYSVALMHRRDTRKVKLRILQKYFPLNSW 549 C+ + L +F + +A H T + LRIL Y+ L SW Sbjct: 379 CSIFLLELLLVIFQVPFQMAKKHFLGTNRYPLRILPSYYFLKSW 422 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,723,617 Number of Sequences: 37544 Number of extensions: 373483 Number of successful extensions: 944 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 912 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 944 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1909952136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -