BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00375 (634 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 1.6 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 6.5 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 23.4 bits (48), Expect = 1.6 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +3 Query: 360 PSQPLNKSICHVLKPRTLRSGFLS 431 P QP +K+ C L +T+R ++S Sbjct: 1100 PEQPPDKATCTTLTAQTIRVSWVS 1123 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.4 bits (43), Expect = 6.5 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +2 Query: 485 QRV*TNETLLNSFSLRC 535 Q + + E+LLNS +RC Sbjct: 63 QELKSQESLLNSIQIRC 79 Score = 21.0 bits (42), Expect = 8.6 Identities = 9/46 (19%), Positives = 21/46 (45%) Frame = +2 Query: 332 RHPEKRLKAAFTAFEQINLPRLKAENPSLRLSQLKELLKKEWHKSP 469 RH +KR F+ ++ +L ++ ++ +K + +W P Sbjct: 403 RHKQKRRDERERYFKGLDEEKLPESGENIEINLIKPDIFDQWELGP 448 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,321 Number of Sequences: 336 Number of extensions: 1965 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16292796 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -