BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00372 (662 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12083| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_22835| Best HMM Match : zf-C2H2 (HMM E-Value=0) 32 0.48 SB_51905| Best HMM Match : zf-C2H2 (HMM E-Value=0) 31 1.1 SB_55441| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_9634| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 2.6 SB_3604| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_20597| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 2.6 SB_37930| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_16971| Best HMM Match : zf-C2H2 (HMM E-Value=5.8e-36) 29 3.4 SB_53497| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 3.4 SB_34111| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 3.4 SB_8757| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 3.4 SB_5461| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_48551| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_42899| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_17982| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_10756| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_10357| Best HMM Match : zf-C2H2 (HMM E-Value=9.8e-38) 29 4.5 SB_57| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 4.5 SB_54952| Best HMM Match : 7tm_1 (HMM E-Value=7.2e-16) 29 4.5 SB_12745| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_59700| Best HMM Match : SCP (HMM E-Value=1.6e-14) 28 5.9 SB_27631| Best HMM Match : zf-C2H2 (HMM E-Value=0.0041) 28 5.9 SB_1728| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 7.8 SB_38222| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 >SB_12083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1671 Score = 33.1 bits (72), Expect = 0.21 Identities = 19/49 (38%), Positives = 31/49 (63%), Gaps = 2/49 (4%) Frame = -2 Query: 457 TIALMYSASNIKCCTH-YLPTYCNFFAPTYSLVAYYSG-YAWTGLIVAS 317 T +L+ + +N+ TH L Y N FAPT+SL+A Y+ +A T ++A+ Sbjct: 96 THSLLANYTNLFAPTHSLLANYTNLFAPTHSLLANYTNLFAMTHSLLAN 144 Score = 32.7 bits (71), Expect = 0.27 Identities = 19/49 (38%), Positives = 31/49 (63%), Gaps = 2/49 (4%) Frame = -2 Query: 457 TIALMYSASNIKCCTH-YLPTYCNFFAPTYSLVAYYSG-YAWTGLIVAS 317 T +L+ + +N+ TH L Y N FAPT+SL+A Y+ +A T ++A+ Sbjct: 124 THSLLANYTNLFAMTHSLLANYTNLFAPTHSLLANYTNLFAPTHSLLAN 172 Score = 32.7 bits (71), Expect = 0.27 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = -2 Query: 478 HVTLQYLTIALMYSASNIKCCTH-YLPTYCNFFAPTYSLVAYYS 350 + L +T +L+ + +N+ TH L Y N FAPT+SL+A Y+ Sbjct: 131 YTNLFAMTHSLLANYTNLFAPTHSLLANYTNLFAPTHSLLANYT 174 Score = 32.3 bits (70), Expect = 0.36 Identities = 16/37 (43%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = -2 Query: 457 TIALMYSASNIKCCTH-YLPTYCNFFAPTYSLVAYYS 350 T +L+ + +N+ TH L Y N FAPT+SL+A Y+ Sbjct: 222 THSLLANYTNLFATTHSLLANYTNLFAPTHSLLANYT 258 Score = 31.1 bits (67), Expect = 0.84 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = -2 Query: 457 TIALMYSASNIKCCTHYLPT-YCNFFAPTYSLVAYYS 350 T +L+ + +N+ TH LP Y N FAPT++ +A Y+ Sbjct: 166 THSLLANYTNLFAPTHSLPANYTNLFAPTHTTLANYT 202 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -2 Query: 457 TIALMYSASNIKCCTH-YLPTYCNFFAPTYSLVAYYS 350 T +L+ + +N+ TH L Y N FAPT+SL A Y+ Sbjct: 152 THSLLANYTNLFAPTHSLLANYTNLFAPTHSLPANYT 188 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = -2 Query: 433 SNIKCCTH-YLPTYCNFFAPTYSLVAYYSG-YAWTGLIVAS 317 +N+ TH L Y N FAPT+SL+A Y+ +A T ++A+ Sbjct: 90 TNLFAPTHSLLANYTNLFAPTHSLLANYTNLFAPTHSLLAN 130 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = -2 Query: 406 LPTYCNFFAPTYSLVAYYSG-YAWTGLIVAS 317 L Y N FAPT+SL+A Y+ +A T ++A+ Sbjct: 212 LANYTNLFAPTHSLLANYTNLFATTHSLLAN 242 Score = 27.9 bits (59), Expect = 7.8 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = -2 Query: 406 LPTYCNFFAPTYSLVAYYSG-YAWTGLIVAS 317 L Y N FAPT+SL+A Y+ +A T ++A+ Sbjct: 86 LANYTNLFAPTHSLLANYTNLFAPTHSLLAN 116 >SB_22835| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 594 Score = 31.9 bits (69), Expect = 0.48 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +2 Query: 2 HVCPMCERRYSSKAALVTHFKIHLNNNKVI*IRLKQL 112 H C MC + + K ALV H K HL + +RLK L Sbjct: 176 HACWMCHKAFKHKTALVLHKKTHLEYQEWR-VRLKTL 211 >SB_51905| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 928 Score = 30.7 bits (66), Expect = 1.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +2 Query: 2 HVCPMCERRYSSKAALVTHFKIHLNNNK 85 HVC +C++ +S +AL H +IHL + Sbjct: 424 HVCDICKKMLASSSALSRHKRIHLQKKQ 451 >SB_55441| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 694 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +2 Query: 8 CPMCERRYSSKAALVTHFKIHLN 76 C C++ +SS L TH KIH N Sbjct: 379 CEECDKAFSSSCGLSTHKKIHFN 401 Score = 29.1 bits (62), Expect = 3.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 Query: 2 HVCPMCERRYSSKAALVTHFKIH 70 H C CE+ + +KA L HF+ H Sbjct: 517 HECTQCEKAFITKAKLDRHFRTH 539 Score = 27.9 bits (59), Expect = 7.8 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 8 CPMCERRYSSKAALVTHFKIHLNNNK 85 C +CE+ + K +L H +IH NN+K Sbjct: 547 CEICEKSFRDKDSLNIHMRIH-NNDK 571 >SB_9634| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 587 Score = 29.5 bits (63), Expect = 2.6 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 2 HVCPMCERRYSSKAALVTHFKIH 70 +VC C++ +SSK+ L H K+H Sbjct: 447 YVCQTCDKTFSSKSNLDQHLKLH 469 >SB_3604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1319 Score = 29.5 bits (63), Expect = 2.6 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +2 Query: 2 HVCPMCERRYSSKAALVTHFKIH 70 H CP C R + ++ L++H +IH Sbjct: 1293 HWCPTCGRGFLARIGLISHLRIH 1315 >SB_20597| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 268 Score = 29.5 bits (63), Expect = 2.6 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 2 HVCPMCERRYSSKAALVTHFKIH 70 H C +CE+ + +K L HF+ H Sbjct: 78 HKCSICEKGFKTKRCLTKHFRTH 100 >SB_37930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 707 Score = 29.1 bits (62), Expect = 3.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 Query: 8 CPMCERRYSSKAALVTHFKIHLN 76 C CE+ Y+ K+ L H K+H N Sbjct: 648 CNWCEKSYTRKSNLTAHLKMHKN 670 >SB_16971| Best HMM Match : zf-C2H2 (HMM E-Value=5.8e-36) Length = 477 Score = 29.1 bits (62), Expect = 3.4 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = +2 Query: 2 HVCPMCERRYSSKAALVTHFKIH 70 H C +C++R+S ++L H ++H Sbjct: 304 HECHVCQKRFSQSSSLNKHMRVH 326 >SB_53497| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 462 Score = 29.1 bits (62), Expect = 3.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 2 HVCPMCERRYSSKAALVTHFKIH 70 H C CE R++ L TH K+H Sbjct: 201 HQCGKCEMRFTQHEMLKTHLKVH 223 >SB_34111| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 757 Score = 29.1 bits (62), Expect = 3.4 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +2 Query: 8 CPMCERRYSSKAALVTHFKIH 70 CP+C +R+ +++AL H K+H Sbjct: 556 CPLCTQRFVNQSALNVHQKVH 576 >SB_8757| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 539 Score = 29.1 bits (62), Expect = 3.4 Identities = 8/21 (38%), Positives = 16/21 (76%) Frame = +2 Query: 8 CPMCERRYSSKAALVTHFKIH 70 C +C++R+S + ++TH +IH Sbjct: 467 CTICKKRFSKQGNMITHARIH 487 >SB_5461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1766 Score = 29.1 bits (62), Expect = 3.4 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +2 Query: 8 CPMCERRYSSKAALVTHFKIHLNNNK 85 CP C R + ++ L++H + H NK Sbjct: 974 CPQCPRLFRAQIGLISHLRTHKPTNK 999 >SB_48551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 560 Score = 28.7 bits (61), Expect = 4.5 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +2 Query: 2 HVCPMCERRYSSKAALVTHFKIH 70 H C +C +R+S ++L H ++H Sbjct: 381 HQCSVCSKRFSQSSSLNKHMRVH 403 >SB_42899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 490 Score = 28.7 bits (61), Expect = 4.5 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = +2 Query: 2 HVCPMCERRYSSKAALVTHFKIH 70 H C +C++R+S ++L H ++H Sbjct: 315 HECHVCKKRFSQSSSLNKHMRVH 337 >SB_17982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 474 Score = 28.7 bits (61), Expect = 4.5 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 2 HVCPMCERRYSSKAALVTHFKIH 70 H C +CE+ ++ A LV H + H Sbjct: 381 HQCHLCEKAFTKPATLVDHIRTH 403 >SB_10756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 713 Score = 28.7 bits (61), Expect = 4.5 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +2 Query: 2 HVCPMCERRYSSKAALVTHFKIHLN 76 +VCP C + ++ + L TH + H N Sbjct: 677 YVCPQCNKAFNRASNLHTHMRTHTN 701 >SB_10357| Best HMM Match : zf-C2H2 (HMM E-Value=9.8e-38) Length = 509 Score = 28.7 bits (61), Expect = 4.5 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +2 Query: 8 CPMCERRYSSKAALVTHFKIH 70 C +C RR++ +++ TH +IH Sbjct: 429 CHICHRRFAQSSSVTTHMRIH 449 >SB_57| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1498 Score = 28.7 bits (61), Expect = 4.5 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +2 Query: 5 VCPMCERRYSSKAALVTHFKIHLN 76 VC +C++ + SK AL+ H HL+ Sbjct: 508 VCSVCDKEFRSKTALINHQVKHLD 531 >SB_54952| Best HMM Match : 7tm_1 (HMM E-Value=7.2e-16) Length = 357 Score = 28.7 bits (61), Expect = 4.5 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = -1 Query: 428 YQMLHTLSTYLL*FFCPYLFT 366 Y++ + ++ +L FFCPYLFT Sbjct: 242 YKLSYMAASVILVFFCPYLFT 262 >SB_12745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 501 Score = 28.7 bits (61), Expect = 4.5 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +2 Query: 5 VCPMCERRYSSKAALVTHFKIHLN 76 VC +C++ + SK AL+ H HL+ Sbjct: 440 VCSVCDKEFRSKTALINHQVKHLD 463 >SB_59700| Best HMM Match : SCP (HMM E-Value=1.6e-14) Length = 427 Score = 28.3 bits (60), Expect = 5.9 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 8 CPMCERRYSSKAALVTHFKIHLNNN 82 C +CER++ + L TH K+H N Sbjct: 181 CEICERKFKYLSNLRTHLKVHKKMN 205 >SB_27631| Best HMM Match : zf-C2H2 (HMM E-Value=0.0041) Length = 117 Score = 28.3 bits (60), Expect = 5.9 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +2 Query: 8 CPMCERRYSSKAALVTHFKIH 70 CP C R +S++ L++H + H Sbjct: 94 CPQCPRLFSAQIGLISHLRTH 114 >SB_1728| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 935 Score = 27.9 bits (59), Expect = 7.8 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +2 Query: 2 HVCPMCERRYSSKAALVTHFKIHLNNNK 85 H CP+C++ +S + L H IH N + Sbjct: 777 HRCPVCKKCFSRASLLKQHSVIHQGNKR 804 >SB_38222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 356 Score = 27.9 bits (59), Expect = 7.8 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +2 Query: 5 VCPMCERRYSSKAALVTHFKIH 70 VCP C R + ++ LV+H + H Sbjct: 331 VCPECGRAFHARIGLVSHLRTH 352 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,376,733 Number of Sequences: 59808 Number of extensions: 307964 Number of successful extensions: 828 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 828 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -