BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00371 (670 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT022423-1|AAY54839.1| 219|Drosophila melanogaster IP08047p pro... 29 5.7 AE014297-439|AAG22206.1| 211|Drosophila melanogaster CG17917-PA... 29 5.7 >BT022423-1|AAY54839.1| 219|Drosophila melanogaster IP08047p protein. Length = 219 Score = 29.1 bits (62), Expect = 5.7 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 10/50 (20%) Frame = +1 Query: 271 TSTENFQEFLFQKRDYFNFD-------SAKSE---ETIRFVTSYDYAHPI 390 T T F L+++RDY FD S K ET RF Y + HP+ Sbjct: 140 TGTHRFVFLLYKQRDYTKFDFPKLPKHSVKGRSGFETKRFAKKYRFGHPV 189 >AE014297-439|AAG22206.1| 211|Drosophila melanogaster CG17917-PA protein. Length = 211 Score = 29.1 bits (62), Expect = 5.7 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 10/50 (20%) Frame = +1 Query: 271 TSTENFQEFLFQKRDYFNFD-------SAKSE---ETIRFVTSYDYAHPI 390 T T F L+++RDY FD S K ET RF Y + HP+ Sbjct: 132 TGTHRFVFLLYKQRDYTKFDFPKLPKHSVKGRSGFETKRFAKKYRFGHPV 181 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,109,811 Number of Sequences: 53049 Number of extensions: 601526 Number of successful extensions: 2277 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2207 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2277 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2889369000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -