BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00367 (670 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 23 2.6 DQ435325-1|ABD92640.1| 160|Apis mellifera OBP7 protein. 23 3.5 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 23.0 bits (47), Expect = 2.6 Identities = 12/48 (25%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +1 Query: 400 IFREIMRNLPLLNHTLLPEFLLPPISNFARSEAY-VNFRIRKLVGVNI 540 I + + ++ L+N T LP+ + R++AY V + G+N+ Sbjct: 273 ILKGLKTSIILMNGTTLPQIMWGTKETSTRTDAYTVEIVLEPGTGINV 320 >DQ435325-1|ABD92640.1| 160|Apis mellifera OBP7 protein. Length = 160 Score = 22.6 bits (46), Expect = 3.5 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 215 IVFVYINSIS*LIRFDDIKTIHK 283 ++FVYI S++ +IR + I I K Sbjct: 6 VIFVYILSVAVIIRANGINEILK 28 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,867 Number of Sequences: 438 Number of extensions: 3294 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20221290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -