BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00367 (670 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g62940.1 68414.m07107 4-coumarate--CoA ligase family protein ... 29 3.7 >At1g62940.1 68414.m07107 4-coumarate--CoA ligase family protein / 4-coumaroyl-CoA synthase family protein similar to gi:112801 from Petroselinum crispum, GB:AAD40664 from [Solanum tuberosum] (J. Biol. Chem. 266 (13), 8551-8559 (1991)); contains Pfam AMP-binding enzyme domain PF00501 Length = 542 Score = 28.7 bits (61), Expect = 3.7 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 388 DTFTIFREIMRNLPLLNHTLLPEFLLPPISNFARSEAYV 504 D IFR + ++P+ + LPEF+L + + + A+V Sbjct: 8 DNEYIFRSLYPSVPIPDKLTLPEFVLQGVEEYTENVAFV 46 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,196,345 Number of Sequences: 28952 Number of extensions: 222539 Number of successful extensions: 429 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 426 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 429 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1412971776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -