BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00364X (496 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC576.06c |||tyrosine-tRNA ligase|Schizosaccharomyces pombe|ch... 25 6.3 SPAC9E9.10c |cbh1|cbh|centromere binding protein |Schizosaccharo... 25 8.3 >SPCC576.06c |||tyrosine-tRNA ligase|Schizosaccharomyces pombe|chr 3|||Manual Length = 445 Score = 25.0 bits (52), Expect = 6.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 258 LIENPTIRQSSCSCSLIYLMISETA 184 LI N T+ Q SC+ + +YL TA Sbjct: 16 LIHNTTLLQPSCNVNSVYLGADPTA 40 >SPAC9E9.10c |cbh1|cbh|centromere binding protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 514 Score = 24.6 bits (51), Expect = 8.3 Identities = 14/54 (25%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = +2 Query: 74 LSDTAVMDMMVSTLQQQRAVTEQLRR-EAAIKRIPVSVAVSDIIKYINEHEQED 232 L AV + L+++R +++ E I + ++A +IKY +HE D Sbjct: 440 LHQDAVDTVAAEFLEERRFESDEEEDVEPQISNVEAAMAFEVLIKYFEQHENGD 493 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,686,637 Number of Sequences: 5004 Number of extensions: 27765 Number of successful extensions: 53 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 53 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 53 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 194131776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -