BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00364X (496 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7877| Best HMM Match : G-gamma (HMM E-Value=6.9e-15) 51 5e-07 SB_11312| Best HMM Match : Ank (HMM E-Value=2.1e-18) 29 2.8 SB_53549| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 >SB_7877| Best HMM Match : G-gamma (HMM E-Value=6.9e-15) Length = 70 Score = 51.2 bits (117), Expect = 5e-07 Identities = 23/44 (52%), Positives = 30/44 (68%) Frame = +2 Query: 113 LQQQRAVTEQLRREAAIKRIPVSVAVSDIIKYINEHEQEDCLMV 244 LQ+QR V EQLRRE IKR+ VS DI+ + EHE +D L++ Sbjct: 9 LQRQRVVVEQLRREVNIKRLKVSQCAGDIVDFCKEHESQDQLVI 52 >SB_11312| Best HMM Match : Ank (HMM E-Value=2.1e-18) Length = 516 Score = 28.7 bits (61), Expect = 2.8 Identities = 16/45 (35%), Positives = 19/45 (42%) Frame = +1 Query: 106 INVTAAAGCN*AAPQRSSNKENPGICSSFRYHQVYQ*TRARRLPY 240 IN AG N AP NK PG + Y+ YQ + PY Sbjct: 175 INKLMRAGANIIAPISVVNKFPPGTVVDYAYNVFYQDRKIAHTPY 219 >SB_53549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 27.9 bits (59), Expect = 4.9 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 Query: 52 CFCFQHRPLGHSRN 93 C+CF +R LGH RN Sbjct: 158 CYCFANRHLGHKRN 171 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,400,642 Number of Sequences: 59808 Number of extensions: 205349 Number of successful extensions: 385 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 363 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 385 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1062812967 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -