BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00364X (496 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 7.6 AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakini... 22 10.0 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 22.6 bits (46), Expect = 7.6 Identities = 12/41 (29%), Positives = 15/41 (36%) Frame = +1 Query: 55 FCFQHRPLGHSRNGYDGINVTAAAGCN*AAPQRSSNKENPG 177 F +QH H NG G + S+K NPG Sbjct: 1396 FSYQHPHPHHHHNGSGRSKPPGPEGVGGGGGKSPSDKHNPG 1436 >AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakinin GPCR protein. Length = 634 Score = 22.2 bits (45), Expect = 10.0 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -1 Query: 190 NCYRYRDSLYCCF 152 +CYR R + CCF Sbjct: 539 SCYRNRMPICCCF 551 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 426,256 Number of Sequences: 2352 Number of extensions: 6927 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43977336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -