Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS00364X
         (496 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein.           23   7.6  
AY347952-1|AAR28375.1|  634|Anopheles gambiae putative sulfakini...    22   10.0 

>AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein.
          Length = 1459

 Score = 22.6 bits (46), Expect = 7.6
 Identities = 12/41 (29%), Positives = 15/41 (36%)
 Frame = +1

Query: 55   FCFQHRPLGHSRNGYDGINVTAAAGCN*AAPQRSSNKENPG 177
            F +QH    H  NG          G      +  S+K NPG
Sbjct: 1396 FSYQHPHPHHHHNGSGRSKPPGPEGVGGGGGKSPSDKHNPG 1436


>AY347952-1|AAR28375.1|  634|Anopheles gambiae putative sulfakinin
           GPCR protein.
          Length = 634

 Score = 22.2 bits (45), Expect = 10.0
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = -1

Query: 190 NCYRYRDSLYCCF 152
           +CYR R  + CCF
Sbjct: 539 SCYRNRMPICCCF 551


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 426,256
Number of Sequences: 2352
Number of extensions: 6927
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 43977336
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)