BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00336 (431 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-b... 25 1.2 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 25 1.5 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 23 6.1 AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CY... 22 8.1 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 22 8.1 >AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-binding protein OBPjj17 protein. Length = 285 Score = 25.0 bits (52), Expect = 1.2 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -2 Query: 241 GRNKQGGGTYPRGLTRGPTTSNYANYNFAGLI 146 G+ Q GG YPRG R + Y + G + Sbjct: 253 GQYDQRGGNYPRGTERNRNGNGYGAGDDGGYV 284 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 24.6 bits (51), Expect = 1.5 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 46 RIPQAGTNFSNEICTQQMFTIDFHGEG 126 R AGT F + +++ F HGEG Sbjct: 286 RFQHAGTRFKTKQFSKENFLATLHGEG 312 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 22.6 bits (46), Expect = 6.1 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 Query: 108 NREHLLSTYFIRKISTRLRDSN 43 N EH +T+F+RKI SN Sbjct: 326 NGEHKTNTHFMRKIPPGAEASN 347 >AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CYP12F4 protein. Length = 521 Score = 22.2 bits (45), Expect = 8.1 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = -1 Query: 146 FYXYDVIPSPWKSI 105 FY D++PS W+ + Sbjct: 245 FYQLDILPSIWRKL 258 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 22.2 bits (45), Expect = 8.1 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -1 Query: 227 GRWYLSARTHKRS 189 GRW L TH++S Sbjct: 791 GRWVLDKETHRKS 803 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 490,771 Number of Sequences: 2352 Number of extensions: 9288 Number of successful extensions: 68 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 35717724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -