BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00335 (693 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0036 + 3217163-3217584,3217752-3218322 30 1.5 02_05_0244 - 27130502-27130843,27130914-27131019,27132170-27132411 30 1.5 12_01_1024 - 10467644-10469274,10469424-10469482,10469820-104703... 30 2.0 05_03_0258 - 11153709-11156090 29 4.6 06_01_0092 - 775290-775691 28 8.1 >09_02_0036 + 3217163-3217584,3217752-3218322 Length = 330 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 71 ITIHWPSFYNVV-TGKTLALPNLIALQH 151 I+ W F N+V +G TL++PN + LQH Sbjct: 69 ISAGWSRFINLVQSGPTLSIPNYVLLQH 96 >02_05_0244 - 27130502-27130843,27130914-27131019,27132170-27132411 Length = 229 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = -1 Query: 618 RPSARSFRFLPFLSRHVRRLSPSSSKSGAP 529 R SA R+ PFLSR +R S S+ SG P Sbjct: 191 RRSATDGRYAPFLSRQPQRSSAGSTHSGKP 220 >12_01_1024 - 10467644-10469274,10469424-10469482,10469820-10470357, 10470975-10471666,10471912-10472062,10473797-10473864, 10473964-10474042,10474763-10474765,10476427-10477255 Length = 1349 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -1 Query: 630 YTCQRPSA-RSFRFLPFLSRHVRRLSPSSSK 541 Y CQ P ++FRF+ SRH R+ SS K Sbjct: 1313 YECQEPGCGQTFRFVSDFSRHKRKTGHSSDK 1343 >05_03_0258 - 11153709-11156090 Length = 793 Score = 28.7 bits (61), Expect = 4.6 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = -2 Query: 254 INAYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLSWVT 123 +N YNL F + + + R +L ++++ GC R++W T Sbjct: 391 VNTYNLIFGMLGK---KSRFTAMLEMLEEMSRSGCTPNRVTWNT 431 >06_01_0092 - 775290-775691 Length = 133 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -2 Query: 191 RASSLLRQLAKGGCAARR 138 RA+SLLRQL + GCAA + Sbjct: 22 RAASLLRQLIEDGCAAAK 39 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,515,916 Number of Sequences: 37544 Number of extensions: 360406 Number of successful extensions: 914 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 893 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 914 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -