BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00331 (663 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 25 0.73 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 25 0.73 U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 23 2.2 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 23 2.2 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 23 2.2 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 3.0 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 3.0 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 3.0 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 3.0 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 3.0 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 3.0 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 23 3.0 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 3.0 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 22 3.9 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 22 5.2 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 6.8 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 9.0 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 9.0 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 24.6 bits (51), Expect = 0.73 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = +3 Query: 480 REAVTWGVWAHRVPRETSRLLRHCAHQGLHGTHLRHEV 593 RE +TW H R +R R C H GT +R + Sbjct: 593 REQLTWRRNFHGPHRLAARSRRCCYHAVAPGTDIRQSI 630 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 24.6 bits (51), Expect = 0.73 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = +3 Query: 480 REAVTWGVWAHRVPRETSRLLRHCAHQGLHGTHLRHEV 593 RE +TW H R +R R C H GT +R + Sbjct: 485 REQLTWRRNFHGPHRLAARSRRCCYHAVAPGTDIRQSI 522 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 23.0 bits (47), Expect = 2.2 Identities = 15/58 (25%), Positives = 28/58 (48%) Frame = -1 Query: 516 HDGPTRPKLRPPVIIHKFPDSNLMKSIIFVVAMSNWMESLTLISGSG*RMVRPSCVTK 343 H P ++RPP++ P + + V + SN +++L I+ + V P+C K Sbjct: 93 HGPPIHHQIRPPILHDTQPMCESLNTQPPVTSSSNILQNLADITPN----VTPNCDVK 146 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 23.0 bits (47), Expect = 2.2 Identities = 15/58 (25%), Positives = 28/58 (48%) Frame = -1 Query: 516 HDGPTRPKLRPPVIIHKFPDSNLMKSIIFVVAMSNWMESLTLISGSG*RMVRPSCVTK 343 H P ++RPP++ P + + V + SN +++L I+ + V P+C K Sbjct: 93 HGPPIHHQIRPPILHDTQPMCESLNTQPPVTSSSNILQNLADITPN----VTPNCDVK 146 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 23.0 bits (47), Expect = 2.2 Identities = 15/58 (25%), Positives = 28/58 (48%) Frame = -1 Query: 516 HDGPTRPKLRPPVIIHKFPDSNLMKSIIFVVAMSNWMESLTLISGSG*RMVRPSCVTK 343 H P ++RPP++ P + + V + SN +++L I+ + V P+C K Sbjct: 93 HGPPIHHQIRPPILHDTQPMCESLNTQPPVTSSSNILQNLADITPN----VTPNCDVK 146 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.0 Identities = 12/55 (21%), Positives = 22/55 (40%) Frame = +2 Query: 263 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIAT 427 H + P Y + +R+A+ P TH + +Y D + D++T Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.0 Identities = 12/55 (21%), Positives = 22/55 (40%) Frame = +2 Query: 263 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIAT 427 H + P Y + +R+A+ P TH + +Y D + D++T Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.6 bits (46), Expect = 3.0 Identities = 12/55 (21%), Positives = 22/55 (40%) Frame = +2 Query: 263 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIAT 427 H + P Y + +R+A+ P TH + +Y D + D++T Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.0 Identities = 12/55 (21%), Positives = 22/55 (40%) Frame = +2 Query: 263 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIAT 427 H + P Y + +R+A+ P TH + +Y D + D++T Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.6 bits (46), Expect = 3.0 Identities = 12/55 (21%), Positives = 22/55 (40%) Frame = +2 Query: 263 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIAT 427 H + P Y + +R+A+ P TH + +Y D + D++T Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 22.6 bits (46), Expect = 3.0 Identities = 12/55 (21%), Positives = 22/55 (40%) Frame = +2 Query: 263 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIAT 427 H + P Y + +R+A+ P TH + +Y D + D++T Sbjct: 20 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 74 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 22.6 bits (46), Expect = 3.0 Identities = 12/55 (21%), Positives = 22/55 (40%) Frame = +2 Query: 263 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIAT 427 H + P Y + +R+A+ P TH + +Y D + D++T Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 3.0 Identities = 12/55 (21%), Positives = 22/55 (40%) Frame = +2 Query: 263 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIAT 427 H + P Y + +R+A+ P TH + +Y D + D++T Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 22.2 bits (45), Expect = 3.9 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -1 Query: 477 IIHKFPDSNLMKSIIFVVAMSNWMESL 397 II +F L + VV +SNW E L Sbjct: 239 IIARFNIERLCNGLKRVVKLSNWREPL 265 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 5.2 Identities = 12/55 (21%), Positives = 21/55 (38%) Frame = +2 Query: 263 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIAT 427 H + P Y + +R+A P TH + +Y D + D++T Sbjct: 64 HGLQPTMGDYTQLQPQRLAPTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.4 bits (43), Expect = 6.8 Identities = 11/38 (28%), Positives = 16/38 (42%) Frame = +2 Query: 476 ITGGRNLGRVGPSCPARDIPAPSTLCTSRTPRDTPSPR 589 +T R P R+ +P++ S TPR T R Sbjct: 916 LTSPRQPAETHAGSPCRNSASPASSDRSGTPRSTNGDR 953 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.0 bits (42), Expect = 9.0 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +3 Query: 279 RRLSTSCVKSSVWRPDLRMFR 341 R+++ C+KS WR L + + Sbjct: 525 RKVTFQCLKSIAWRAFLAVLK 545 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/22 (36%), Positives = 10/22 (45%) Frame = -1 Query: 69 KSPGASTRATCGDRLTVSVHTH 4 K PG S GD + + V H Sbjct: 104 KMPGPSVEVCLGDEVIIDVVNH 125 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,152 Number of Sequences: 336 Number of extensions: 3934 Number of successful extensions: 21 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17177325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -