BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00330 (440 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5MGF5 Cluster: Putative uncharacterized protein; n=2; ... 41 0.010 UniRef50_Q65NQ9 Cluster: Peptidoglycan DL-endopeptidase cwlO pre... 35 0.67 UniRef50_P28618 Cluster: Pyrrolidone-carboxylate peptidase; n=12... 32 4.7 UniRef50_Q0BU79 Cluster: Hypothetical cytosolic protein; n=1; Gr... 32 6.3 UniRef50_O44565 Cluster: Laminin related. see also lmb-protein 1... 32 6.3 >UniRef50_Q5MGF5 Cluster: Putative uncharacterized protein; n=2; Bombycoidea|Rep: Putative uncharacterized protein - Lonomia obliqua (Moth) Length = 74 Score = 41.1 bits (92), Expect = 0.010 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = +2 Query: 134 IYGTGGLLTPLVAPMLGF 187 IYGTGGLLTP+VAPMLGF Sbjct: 17 IYGTGGLLTPIVAPMLGF 34 Score = 33.1 bits (72), Expect = 2.7 Identities = 13/17 (76%), Positives = 17/17 (100%) Frame = +1 Query: 256 GSIVSQLTAAAMVAPTP 306 GS++SQLT+AAM+APTP Sbjct: 58 GSVISQLTSAAMLAPTP 74 >UniRef50_Q65NQ9 Cluster: Peptidoglycan DL-endopeptidase cwlO precursor; n=1; Bacillus licheniformis ATCC 14580|Rep: Peptidoglycan DL-endopeptidase cwlO precursor - Bacillus licheniformis (strain DSM 13 / ATCC 14580) Length = 452 Score = 35.1 bits (77), Expect = 0.67 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 3/74 (4%) Frame = +1 Query: 58 ARREQKLKEHGASSCISGKRGRRCCNIWH---WGSVDSISGSHARFQLSGNSGRKHSRCC 228 A EQKLKE A++ + K S S SGS ++ S NSG S+ Sbjct: 245 AALEQKLKEERAAAAAAAKAKEESATAEKSDSGSSSSSNSGSVSKSDGSSNSGSSSSKKS 304 Query: 229 TSILRKFSGGSIVS 270 +S R +S GS+VS Sbjct: 305 SSPSRNYSSGSVVS 318 >UniRef50_P28618 Cluster: Pyrrolidone-carboxylate peptidase; n=12; Bacilli|Rep: Pyrrolidone-carboxylate peptidase - Bacillus subtilis Length = 215 Score = 32.3 bits (70), Expect = 4.7 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +1 Query: 49 LRIARREQKLKEHGASSCISGKRGRRCCNIWHWGSVDSIS 168 L + R K+KEHG + +S G CN +G +D IS Sbjct: 117 LPVKRMTAKMKEHGIPAAVSYTAGTFVCNYLFYGLMDHIS 156 >UniRef50_Q0BU79 Cluster: Hypothetical cytosolic protein; n=1; Granulibacter bethesdensis CGDNIH1|Rep: Hypothetical cytosolic protein - Granulobacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) Length = 90 Score = 31.9 bits (69), Expect = 6.3 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +1 Query: 70 QKLKEHGA--SSCISGKRGRRCCNIWHWGSVDSISGSHAR 183 Q L+EHG S ++G+R RC N WH G D + R Sbjct: 42 QALREHGTFQGSMLAGRRILRC-NPWHQGGYDPVPAGRCR 80 >UniRef50_O44565 Cluster: Laminin related. see also lmb-protein 1; n=2; Caenorhabditis|Rep: Laminin related. see also lmb-protein 1 - Caenorhabditis elegans Length = 1067 Score = 31.9 bits (69), Expect = 6.3 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = +1 Query: 97 SCISGKRGRRC--CNIWHWGSVDSISGSHARFQLSGN 201 +C SG +G RC C HWGS + G+ R +GN Sbjct: 973 NCKSGYQGERCGECAQNHWGSPREVGGTCERCDCNGN 1009 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 403,035,615 Number of Sequences: 1657284 Number of extensions: 7243569 Number of successful extensions: 16939 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16876 length of database: 575,637,011 effective HSP length: 93 effective length of database: 421,509,599 effective search space used: 22340008747 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -