BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00330 (440 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50387| Best HMM Match : HLH (HMM E-Value=8.2e-05) 30 0.97 SB_19263| Best HMM Match : TAP42 (HMM E-Value=0.25) 29 2.2 SB_27773| Best HMM Match : Mito_carr (HMM E-Value=0) 27 6.9 >SB_50387| Best HMM Match : HLH (HMM E-Value=8.2e-05) Length = 791 Score = 29.9 bits (64), Expect = 0.97 Identities = 12/36 (33%), Positives = 24/36 (66%) Frame = +1 Query: 184 FQLSGNSGRKHSRCCTSILRKFSGGSIVSQLTAAAM 291 FQ++G +G++ + C ++R+F G + SQL+ A+ Sbjct: 133 FQVNGKNGQEET--CEDLVREFEGNGLFSQLSLEAL 166 >SB_19263| Best HMM Match : TAP42 (HMM E-Value=0.25) Length = 303 Score = 28.7 bits (61), Expect = 2.2 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -1 Query: 374 PNKTEKVRSWSDFENG*CLASPHGVGATMAAA 279 P K +K R W D+++G C + +G T+AAA Sbjct: 167 PEKLQKARDWDDWKDGLCGVA---IGYTVAAA 195 >SB_27773| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 203 Score = 27.1 bits (57), Expect = 6.9 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +1 Query: 127 CCNIWHWGSVDSISGSHARFQLSGNSGRKHSRCCTSILRK 246 C ++H G+++ I R Q+ G+ R C TS+ ++ Sbjct: 6 CATVFHDGAMNPIEVIKQRLQMYGSPYRGVIHCATSVFKE 45 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,691,516 Number of Sequences: 59808 Number of extensions: 246257 Number of successful extensions: 509 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 509 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 859323430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -