BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00330 (440 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 23 3.6 AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 23 6.4 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 22 8.4 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 23.4 bits (48), Expect = 3.6 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +1 Query: 190 LSGNSGRKHSRCCTSILRKFSGGSIVSQLTAAAMVAPTP 306 LS N C S+ R S S S L+ VAP P Sbjct: 853 LSHNKVSSLHGSCDSLSRNVSQASSTSDLSKTISVAPDP 891 >AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. Length = 506 Score = 22.6 bits (46), Expect = 6.4 Identities = 5/12 (41%), Positives = 8/12 (66%) Frame = +1 Query: 127 CCNIWHWGSVDS 162 CC +W W ++S Sbjct: 88 CCRLWRWPDLNS 99 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 22.2 bits (45), Expect = 8.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -3 Query: 342 RFRERVMFSITSWRGGYHG 286 R+ R++ I++W+G HG Sbjct: 959 RWTHRIIRDISAWQGRRHG 977 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 428,290 Number of Sequences: 2352 Number of extensions: 7878 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 36993357 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -