BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00330 (440 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF039041-1|AAP46271.1| 1067|Caenorhabditis elegans Laminin relat... 32 0.21 AL117206-13|CAB60454.2| 1651|Caenorhabditis elegans Hypothetical... 29 1.1 AL110498-8|CAB57911.2| 1651|Caenorhabditis elegans Hypothetical ... 29 1.1 Z93339-1|CAB07544.1| 2105|Caenorhabditis elegans Hypothetical pr... 29 2.0 Z70203-7|CAA94110.1| 2105|Caenorhabditis elegans Hypothetical pr... 29 2.0 AL023825-2|CAA19443.1| 2105|Caenorhabditis elegans Hypothetical ... 29 2.0 U61952-8|AAB03166.1| 1372|Caenorhabditis elegans Temporarily ass... 28 2.6 >AF039041-1|AAP46271.1| 1067|Caenorhabditis elegans Laminin related. see also lmb-protein 1 protein. Length = 1067 Score = 31.9 bits (69), Expect = 0.21 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = +1 Query: 97 SCISGKRGRRC--CNIWHWGSVDSISGSHARFQLSGN 201 +C SG +G RC C HWGS + G+ R +GN Sbjct: 973 NCKSGYQGERCGECAQNHWGSPREVGGTCERCDCNGN 1009 >AL117206-13|CAB60454.2| 1651|Caenorhabditis elegans Hypothetical protein Y64G10A.7 protein. Length = 1651 Score = 29.5 bits (63), Expect = 1.1 Identities = 20/52 (38%), Positives = 25/52 (48%), Gaps = 3/52 (5%) Frame = +1 Query: 82 EHGASSCISGKRGRRC---CNIWHWGSVDSISGSHARFQLSGNSGRKHSRCC 228 EH SC+SG G +C C + D ISG H Q G G+K +R C Sbjct: 1195 EHCEKSCVSGHYGAKCEETCECENGALCDPISG-HCSCQ-PGWRGKKCNRPC 1244 >AL110498-8|CAB57911.2| 1651|Caenorhabditis elegans Hypothetical protein Y64G10A.7 protein. Length = 1651 Score = 29.5 bits (63), Expect = 1.1 Identities = 20/52 (38%), Positives = 25/52 (48%), Gaps = 3/52 (5%) Frame = +1 Query: 82 EHGASSCISGKRGRRC---CNIWHWGSVDSISGSHARFQLSGNSGRKHSRCC 228 EH SC+SG G +C C + D ISG H Q G G+K +R C Sbjct: 1195 EHCEKSCVSGHYGAKCEETCECENGALCDPISG-HCSCQ-PGWRGKKCNRPC 1244 >Z93339-1|CAB07544.1| 2105|Caenorhabditis elegans Hypothetical protein Y16B4A.2 protein. Length = 2105 Score = 28.7 bits (61), Expect = 2.0 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -1 Query: 362 EKVRSWSDFENG*CLASPHGVGATMAAAVN 273 E V SW+ F N L SPH VG + + N Sbjct: 581 ENVHSWNKFANVLYLESPHQVGYSYSTVAN 610 >Z70203-7|CAA94110.1| 2105|Caenorhabditis elegans Hypothetical protein Y16B4A.2 protein. Length = 2105 Score = 28.7 bits (61), Expect = 2.0 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -1 Query: 362 EKVRSWSDFENG*CLASPHGVGATMAAAVN 273 E V SW+ F N L SPH VG + + N Sbjct: 581 ENVHSWNKFANVLYLESPHQVGYSYSTVAN 610 >AL023825-2|CAA19443.1| 2105|Caenorhabditis elegans Hypothetical protein Y16B4A.2 protein. Length = 2105 Score = 28.7 bits (61), Expect = 2.0 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -1 Query: 362 EKVRSWSDFENG*CLASPHGVGATMAAAVN 273 E V SW+ F N L SPH VG + + N Sbjct: 581 ENVHSWNKFANVLYLESPHQVGYSYSTVAN 610 >U61952-8|AAB03166.1| 1372|Caenorhabditis elegans Temporarily assigned gene nameprotein 137, isoform a protein. Length = 1372 Score = 28.3 bits (60), Expect = 2.6 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +1 Query: 196 GNSGRKHSRCCTSILRKFSGGSIVSQL 276 G S H R C ++L F+GGS+++++ Sbjct: 771 GLSSSSHLRSCRNMLSGFAGGSLIAEI 797 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,325,712 Number of Sequences: 27780 Number of extensions: 175535 Number of successful extensions: 356 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 344 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 356 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 756625558 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -