BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00328 (668 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory recept... 29 0.026 AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory recept... 29 0.026 EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 21 9.1 >AM292366-1|CAL23178.2| 379|Tribolium castaneum gustatory receptor candidate 45 protein. Length = 379 Score = 29.5 bits (63), Expect = 0.026 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = +3 Query: 135 NFFRNKLKLMSFLRKRCNVNPARGPFHFRAP--SKILWKTVR 254 N+ + ++ +SF K CN+ P+ F P K LWK ++ Sbjct: 5 NYSKKDIRSLSFFYKICNIFGIVPPYSFEKPDSQKSLWKKIQ 46 >AM292329-1|CAL23141.2| 379|Tribolium castaneum gustatory receptor candidate 8 protein. Length = 379 Score = 29.5 bits (63), Expect = 0.026 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = +3 Query: 135 NFFRNKLKLMSFLRKRCNVNPARGPFHFRAP--SKILWKTVR 254 N+ + ++ +SF K CN+ P+ F P K LWK ++ Sbjct: 5 NYSKKDIRSLSFFYKICNIFGIVPPYSFEKPDSQKSLWKKIQ 46 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 21.0 bits (42), Expect = 9.1 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = -2 Query: 43 QMTTAIDHYGLIAK 2 Q+ +A+D YGL+A+ Sbjct: 137 QLFSAVDPYGLVAQ 150 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,778 Number of Sequences: 336 Number of extensions: 3453 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17385535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -