BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00323 (724 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 26 0.41 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 24 1.3 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 3.9 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 22 5.1 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 22 6.7 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 22 6.7 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 21 8.9 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 25.8 bits (54), Expect = 0.41 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +2 Query: 137 RVCEINEHGDAMCNCIKDCPYETDSRRMVCTNFNET 244 +VC H D+ C C+ DS V NFNE+ Sbjct: 344 QVCRSRRHSDSCCLCL-------DSMNAVIRNFNES 372 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 24.2 bits (50), Expect = 1.3 Identities = 9/46 (19%), Positives = 22/46 (47%) Frame = +3 Query: 459 DPSLPEDGAGGGIKPHARWANAAIWKWCDLDAQTNDRFVSRHELFP 596 + LP+ + ++P ++ + +W+ C + + SR + FP Sbjct: 80 EEKLPKTSSNASVEPDSKVTYSGLWRVCVAISSRMEYECSRIDYFP 125 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.6 bits (46), Expect = 3.9 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +1 Query: 124 LQRSTCLRNQRTRRRHV*L-HQGLSLRDRLQTHGVHKLQRNLAIGCEVYR 270 LQ C+R +RT++R+V + L + T G H N+ C ++R Sbjct: 1645 LQDHDCIRQERTQQRNVISDSESGRLDTEMSTWGYH---HNVNKHCTIHR 1691 Score = 21.8 bits (44), Expect = 6.7 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 337 EYYGTCREMPDCTESEMSDFPRRMRD 414 +Y + MPD E+E+SD +RD Sbjct: 74 QYARVQQSMPDGWETEISDQMLELRD 99 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 22.2 bits (45), Expect = 5.1 Identities = 9/28 (32%), Positives = 12/28 (42%) Frame = +2 Query: 143 CEINEHGDAMCNCIKDCPYETDSRRMVC 226 C EH + DC E +RR +C Sbjct: 301 CVSGEHLSVSGGALNDCHAEVVARRCLC 328 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.8 bits (44), Expect = 6.7 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -2 Query: 456 LSTFSHVAHDVKKPVPHATGEVRH 385 +++FSH + DVK + ATG H Sbjct: 276 IASFSHRSIDVKDGIVLATGITVH 299 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.8 bits (44), Expect = 6.7 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -2 Query: 456 LSTFSHVAHDVKKPVPHATGEVRH 385 +++FSH + DVK + ATG H Sbjct: 276 IASFSHRSIDVKDGIVLATGITVH 299 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 21.4 bits (43), Expect = 8.9 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +1 Query: 541 AIWTLRPMIDSCPVTSCSP 597 A+W L I S P+ C P Sbjct: 162 AVWVLAGAITSPPLLGCFP 180 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,013 Number of Sequences: 438 Number of extensions: 4571 Number of successful extensions: 12 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -