BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00322 (292 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24683| Best HMM Match : Toxin_3 (HMM E-Value=4.9) 25 8.0 SB_55063| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 8.0 SB_8268| Best HMM Match : Rabaptin (HMM E-Value=6.4) 25 8.0 >SB_24683| Best HMM Match : Toxin_3 (HMM E-Value=4.9) Length = 223 Score = 25.4 bits (53), Expect = 8.0 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -3 Query: 152 TIHLNSYNLCHINSKSVTIHLDGGFYLYICDEL 54 TI N +LCH+ S+S L IC EL Sbjct: 165 TIEANGIDLCHLYSRSRLTFLSVATLPTICKEL 197 >SB_55063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 25.4 bits (53), Expect = 8.0 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 149 IHLNSYNLCHINSKSVTIHLDGGFYLYICDEL 54 I N +LCH+ S+S I L IC EL Sbjct: 40 IEANGIDLCHLYSRSRLIFLSVATLPTICKEL 71 >SB_8268| Best HMM Match : Rabaptin (HMM E-Value=6.4) Length = 214 Score = 25.4 bits (53), Expect = 8.0 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 149 IHLNSYNLCHINSKSVTIHLDGGFYLYICDEL 54 I N +LCH+ S+S I L IC EL Sbjct: 154 IEANGIDLCHLYSRSRLIFLSVATLPTICKEL 185 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,524,421 Number of Sequences: 59808 Number of extensions: 110755 Number of successful extensions: 208 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 187 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 207 length of database: 16,821,457 effective HSP length: 70 effective length of database: 12,634,897 effective search space used: 328507322 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -