BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00322 (292 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g28470.1 68417.m04073 26S proteasome regulatory subunit, puta... 26 3.8 At1g77380.1 68414.m09011 amino acid carrier, putative / amino ac... 26 5.0 At1g44100.1 68414.m05094 amino acid permease 5, putative (AAP5) ... 25 6.6 At2g20580.1 68415.m02404 26S proteasome regulatory subunit S2 (R... 25 8.8 >At4g28470.1 68417.m04073 26S proteasome regulatory subunit, putative contains Pfam domain PF01851: Proteasome/cyclosome repeat Length = 1103 Score = 26.2 bits (55), Expect = 3.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 226 DNMKIICNVSTNCTSTLKKKK 288 DNM+ + V T+CT +KKK+ Sbjct: 294 DNMQYVKQVFTSCTDLVKKKQ 314 >At1g77380.1 68414.m09011 amino acid carrier, putative / amino acid permease, putative strong similarity to amino acid carrier GI:3293031 from [Ricinus communis]; contains Pfam profile PF01490: Transmembrane amino acid transporter protein; identical to cDNA AAP3 (Amino Acid Permease) GI:3970651 Length = 476 Score = 25.8 bits (54), Expect = 5.0 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 140 NSYNLCHINSKSVTIHLDGGFYLYICDELSAF 45 N Y L I + ++ IHL G + +Y C L AF Sbjct: 314 NPYWLLDIANAAIVIHLIGAYQVY-CQPLFAF 344 >At1g44100.1 68414.m05094 amino acid permease 5, putative (AAP5) nearly identical to amino acid permease (AAP5) GI:608673 from [Arabidopsis thaliana] Length = 480 Score = 25.4 bits (53), Expect = 6.6 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 140 NSYNLCHINSKSVTIHLDGGFYLYICDELSAF 45 N Y L I + ++ IHL G + +Y C L AF Sbjct: 318 NPYWLLDIANLAIVIHLVGAYQVY-CQPLFAF 348 >At2g20580.1 68415.m02404 26S proteasome regulatory subunit S2 (RPN1) contains an APC-complex (cyclosome) and proteasome component repeat ( PS50248) Length = 891 Score = 25.0 bits (52), Expect = 8.8 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 226 DNMKIICNVSTNCTSTLKKKK 288 DN + + V T+CT LKKK+ Sbjct: 268 DNTQYVKQVFTSCTDLLKKKQ 288 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,217,564 Number of Sequences: 28952 Number of extensions: 73772 Number of successful extensions: 152 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 152 length of database: 12,070,560 effective HSP length: 69 effective length of database: 10,072,872 effective search space used: 271967544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -