BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00321X (549 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 27 0.11 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 25 0.33 U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 23 1.8 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 5.4 U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 21 9.4 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 27.1 bits (57), Expect = 0.11 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = +1 Query: 22 WTSADF-CTNYTCADLHGT-LQVQSSNETCPEVSEAVKKQFVLKEEKIPGKCC 174 WTS+D CT C + + ++ TCP+ +K EK+PG+CC Sbjct: 686 WTSSDNPCTTCFCENGNNKCFTMECPQVTCPDN---------MKLEKVPGECC 729 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 25.4 bits (53), Expect = 0.33 Identities = 20/68 (29%), Positives = 27/68 (39%), Gaps = 1/68 (1%) Frame = +3 Query: 144 QRGEDPGQ-VLSQGRAGRVSRWRQNISGGSGVDDAGPVTNRTCRREDGQLSVGRTVEHCE 320 ++G DPG+ V+ G+ G GP R G L+ E CE Sbjct: 2551 EKGADPGKIVMGMPLYGQSFSLADAADRGLNAKSYGPGEAGEFTRAGGFLAY---YEICE 2607 Query: 321 RQCRRGWT 344 R +RGWT Sbjct: 2608 RVKKRGWT 2615 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 23.0 bits (47), Expect = 1.8 Identities = 13/51 (25%), Positives = 19/51 (37%) Frame = -3 Query: 232 PEPPDIFCRHLDTRPARPWDSTCPGSSPL*ARTVSSQPPTLQDKSRLSFAL 80 P PP ++ H P P PL ++ PP Q + L+ L Sbjct: 163 PPPPPVYTHHYARYHPYPNFGVPPAGIPLQNPGLNLNPPVTQTQLPLNLGL 213 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.4 bits (43), Expect = 5.4 Identities = 6/14 (42%), Positives = 12/14 (85%) Frame = -1 Query: 522 SGQCSWLTSRTPPP 481 + QC+ L++++PPP Sbjct: 41 AAQCNKLSNKSPPP 54 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 20.6 bits (41), Expect = 9.4 Identities = 5/11 (45%), Positives = 9/11 (81%) Frame = +1 Query: 142 LKEEKIPGKCC 174 +K +++PG CC Sbjct: 327 MKPKEVPGPCC 337 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,499 Number of Sequences: 336 Number of extensions: 2109 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13516233 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -