BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00319 (731 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_378| Best HMM Match : TTL (HMM E-Value=1.8) 28 6.8 SB_49160| Best HMM Match : IBR (HMM E-Value=2.5e-15) 28 9.0 >SB_378| Best HMM Match : TTL (HMM E-Value=1.8) Length = 327 Score = 28.3 bits (60), Expect = 6.8 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = -1 Query: 473 NQKSQLSIDNK*LKFIQSA-IFLT*QYIFIVLSIKKFTWQFVYI 345 NQK +S+ + F++ A IFL YI ++L+ ++FTW F I Sbjct: 66 NQKLDMSLLDVISSFLEDAPIFLLQTYI-VLLTRREFTWTFAEI 108 >SB_49160| Best HMM Match : IBR (HMM E-Value=2.5e-15) Length = 582 Score = 27.9 bits (59), Expect = 9.0 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 673 DISECPKCHSSVFLDE 626 DI CP+CHS+V DE Sbjct: 405 DIYYCPRCHSAVVADE 420 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,489,380 Number of Sequences: 59808 Number of extensions: 351171 Number of successful extensions: 418 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 401 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 418 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -