BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00317 (408 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0119 - 931934-932359,933409-933564 28 3.3 03_03_0155 - 14933469-14934335,14934529-14934578,14935435-14935447 28 3.3 06_03_1156 - 28069663-28070393,28070966-28071231,28072023-28072909 27 4.3 03_03_0242 + 15765726-15765965,15766703-15766874,15767056-157672... 27 4.3 02_03_0285 - 17296164-17296203,17296406-17296524,17296572-172967... 27 4.3 03_05_0598 + 26006027-26006746,26007992-26008094,26008847-26012394 27 5.7 11_01_0024 + 163588-163897,164303-164406 27 7.6 >11_01_0119 - 931934-932359,933409-933564 Length = 193 Score = 27.9 bits (59), Expect = 3.3 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +2 Query: 224 PMIRLTPPLPQHHSRWNRIHFRQSPYEERTRKQ 322 P++ LTP + H +WN + +RTR Q Sbjct: 45 PLLALTPQIISMHDQWNCYRASEEGQGKRTRSQ 77 >03_03_0155 - 14933469-14934335,14934529-14934578,14935435-14935447 Length = 309 Score = 27.9 bits (59), Expect = 3.3 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = +1 Query: 115 HNAKYDSKLFRKRVENLHYVL 177 HNAK+ ++++RK E HY+L Sbjct: 281 HNAKFPTEIYRKGQEYKHYML 301 >06_03_1156 - 28069663-28070393,28070966-28071231,28072023-28072909 Length = 627 Score = 27.5 bits (58), Expect = 4.3 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +2 Query: 176 YPRCHPPLASPFRAFWPMIRLTPPLPQHHSRWNRIHFRQSP 298 YP PP A+P + P R PP PQ ++ + Q P Sbjct: 26 YPHHPPPYAAPLPQYAPYARGMPP-PQAQQLYSHLPPHQQP 65 >03_03_0242 + 15765726-15765965,15766703-15766874,15767056-15767209, 15767287-15767350,15767533-15767640,15767817-15767942, 15768037-15768269,15768565-15768787 Length = 439 Score = 27.5 bits (58), Expect = 4.3 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +2 Query: 224 PMIRLTPPLPQHHSRWNRIHFRQSPYEERTRKQA*LRCL 340 P +L+PPL +H + FR+ P +E T Q CL Sbjct: 309 PPEKLSPPLKKHGKGGIKALFRRRPSDELTEDQMDRGCL 347 >02_03_0285 - 17296164-17296203,17296406-17296524,17296572-17296742, 17298878-17298985,17299783-17299905,17300057-17300143, 17300765-17300884 Length = 255 Score = 27.5 bits (58), Expect = 4.3 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = +1 Query: 145 RKRVENLHYVLPQVPSTIGKSIQGILAYDKTHTTASATSLKVESDSLSSI 294 RK VE L V ++PS S+ GI+ Y + AT+L+ E + + I Sbjct: 113 RKDVEILLPVTSRIPSVYDWSVDGIITY--VNKNVQATNLEPEDGTCTRI 160 >03_05_0598 + 26006027-26006746,26007992-26008094,26008847-26012394 Length = 1456 Score = 27.1 bits (57), Expect = 5.7 Identities = 13/53 (24%), Positives = 24/53 (45%) Frame = +1 Query: 82 GTNINRPMVYHHNAKYDSKLFRKRVENLHYVLPQVPSTIGKSIQGILAYDKTH 240 GT+ N+ ++ D KR+ ++HY+ +PS + + DK H Sbjct: 242 GTDWNQEILKRIGGHRDKPSSTKRIRDIHYLTGSLPSAFCMLLVQMGGMDKNH 294 >11_01_0024 + 163588-163897,164303-164406 Length = 137 Score = 26.6 bits (56), Expect = 7.6 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +2 Query: 239 TPPLPQHHSRWNR-IHFRQSPYEERTRKQA*LRCLHLRL 352 TP P HH RW+R H ER K R L LRL Sbjct: 85 TPNAPTHHGRWSRQTHHPHEKDLERIEKSN--RVLLLRL 121 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,174,639 Number of Sequences: 37544 Number of extensions: 206213 Number of successful extensions: 549 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 540 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 548 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 718652880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -