BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00316X (596 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-tran... 32 0.012 AF515525-1|AAM61892.1| 235|Anopheles gambiae glutathione S-tran... 28 0.20 AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transf... 28 0.26 AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-tran... 28 0.26 Z71480-1|CAA96104.1| 209|Anopheles gambiae GSTD2 protein protein. 25 2.5 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 25 2.5 AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. 23 5.7 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 23 7.5 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 23 7.5 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 7.5 AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-h... 23 9.9 >AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-transferase D6 protein. Length = 222 Score = 32.3 bits (70), Expect = 0.012 Identities = 18/60 (30%), Positives = 31/60 (51%) Frame = +1 Query: 52 LIAAQYSGTDVKVAPNFVFGETNKSEDFLKKFPAGKVPAFESADGKVLLTESNAIAYYVA 231 L+ A++ ++ + V + +FLK P +P ADG V++ ES+AI Y+A Sbjct: 19 LLFAKWLKLELNLIELDVLKRDHYKPEFLKLNPQHYIPTLVDADGDVVVWESSAILIYLA 78 >AF515525-1|AAM61892.1| 235|Anopheles gambiae glutathione S-transferase protein. Length = 235 Score = 28.3 bits (60), Expect = 0.20 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +1 Query: 154 GKVPAFESADGKVLLTESNAIAYYVANESLRGGDWLP 264 GKVP DG L ES AI Y+ E G W P Sbjct: 55 GKVPCI--VDGSFRLAESVAIYRYLCREFPTDGHWYP 89 >AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transferase o1 protein. Length = 248 Score = 27.9 bits (59), Expect = 0.26 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +1 Query: 115 TNKSEDFLKKFPAGKVPAFESADGK--VLLTESNAIAYYV 228 + K E +L+K P GKVPA E GK V L ES ++ Y+ Sbjct: 55 SEKPEWYLEKNPLGKVPALE-IPGKEGVTLYESLVLSDYI 93 >AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-transferase D8 protein. Length = 224 Score = 27.9 bits (59), Expect = 0.26 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +3 Query: 390 ELLAALKVLDGHLLTRTFLVTERITLADVIVFSTL 494 +L AL VL+G+L+ + ITLAD + ST+ Sbjct: 130 KLEEALAVLNGYLINNPYAAGPNITLADYSLVSTV 164 >Z71480-1|CAA96104.1| 209|Anopheles gambiae GSTD2 protein protein. Length = 209 Score = 24.6 bits (51), Expect = 2.5 Identities = 11/34 (32%), Positives = 22/34 (64%) Frame = +3 Query: 402 ALKVLDGHLLTRTFLVTERITLADVIVFSTLLHA 503 A+++L+ L F+ ++T+AD+ +F+TL A Sbjct: 135 AVELLNIFLSEHEFVAGSKMTIADISLFATLATA 168 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 24.6 bits (51), Expect = 2.5 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = +1 Query: 259 LPKPVSGSGHHGLTVNYCLLPVLGSSLTLVSCNSTNRMLNVQ 384 LPKP G C+L LG L + N NR + Q Sbjct: 552 LPKPGKPPGESSSYRPLCMLDALGKVLERLILNRLNRHIEQQ 593 >AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. Length = 391 Score = 23.4 bits (48), Expect = 5.7 Identities = 13/49 (26%), Positives = 20/49 (40%) Frame = -1 Query: 191 TFPSALSNAGTFPAGNFFKKSSDLLVSPNTKFGATFTSVPEYCAAINAL 45 T P+ ++ P+ S DLL+ T T PEY ++ L Sbjct: 291 TLPNIVNFIAQLPSDELRLSSIDLLLQSLTAENGTLVQDPEYVYRLSQL 339 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 23.0 bits (47), Expect = 7.5 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = +1 Query: 259 LPKPVSGSGHHGLTVNYCLLPVLGSSLTLVSCNSTNRML 375 LPKP G +G C+L LG L + N + L Sbjct: 544 LPKPGKPPGSNGSYRPLCMLDALGKVLEKLILNRLHNHL 582 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 23.0 bits (47), Expect = 7.5 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 406 KAASSSDFARSTFCLLNCM 350 KA + +DF R +F +LN M Sbjct: 786 KALADADFTRQSFAILNEM 804 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.0 bits (47), Expect = 7.5 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +3 Query: 123 VRRLLEEVSCRKSACIRKCRWKSAPN*KQC 212 VR+ E + AC+RKC P +C Sbjct: 262 VRKCPEHLLKDNGACVRKCPKGKMPQNSEC 291 >AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-helix transcriptionfactor ASH protein. Length = 371 Score = 22.6 bits (46), Expect = 9.9 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +1 Query: 229 ANESLRGGDWLPKPVSGSGHHGLTVNYCLLP 321 AN L G + SGSG+ YC LP Sbjct: 63 ANAKLPGAGPIVSSSSGSGNSSKKYAYCGLP 93 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 693,601 Number of Sequences: 2352 Number of extensions: 14947 Number of successful extensions: 45 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -