BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00310 (502 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BX538342-1|CAD98105.1| 1122|Homo sapiens hypothetical protein pr... 31 2.3 AK023435-1|BAB14573.1| 462|Homo sapiens protein ( Homo sapiens ... 31 2.3 >BX538342-1|CAD98105.1| 1122|Homo sapiens hypothetical protein protein. Length = 1122 Score = 31.1 bits (67), Expect = 2.3 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +3 Query: 138 LNQAKELFESFVKEHNREYKDDADRELHYQSFKKNLAEITN 260 L+ +K F S++K H + Y D E F+K+L +I N Sbjct: 847 LHNSKSFFRSYIKNHIKRYCSDNGGEKMKTFFEKSLIDIKN 887 >AK023435-1|BAB14573.1| 462|Homo sapiens protein ( Homo sapiens cDNA FLJ13373 fis, clone PLACE1000749. ). Length = 462 Score = 31.1 bits (67), Expect = 2.3 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +3 Query: 138 LNQAKELFESFVKEHNREYKDDADRELHYQSFKKNLAEITN 260 L+ +K F S++K H + Y D E F+K+L +I N Sbjct: 187 LHNSKSFFRSYIKNHIKRYCSDNGGEKMKTFFEKSLIDIKN 227 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 62,808,367 Number of Sequences: 237096 Number of extensions: 1129359 Number of successful extensions: 2317 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2286 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2317 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4593178062 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -