BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00299 (419 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18684| Best HMM Match : ATP-synt_F6 (HMM E-Value=1.5e-15) 45 2e-05 SB_32685| Best HMM Match : RCSD (HMM E-Value=0.18) 27 4.8 >SB_18684| Best HMM Match : ATP-synt_F6 (HMM E-Value=1.5e-15) Length = 175 Score = 45.2 bits (102), Expect = 2e-05 Identities = 26/80 (32%), Positives = 41/80 (51%), Gaps = 7/80 (8%) Frame = +1 Query: 22 SKLVGLRAATTSMMVSRNL-------AAAQKATDPIQQLFLDKIREYKXXSAGGKVPDAS 180 S+L +T S+++ RN+ A K DPIQ+LF++K+ YK S GGK+ D++ Sbjct: 81 SRLAVASPSTCSIVLRRNIGTTYAAMAKMDKNADPIQRLFVEKLEAYKQKSKGGKLIDST 140 Query: 181 PAVXXXXXXXXXXXXXQYGG 240 P + +YGG Sbjct: 141 PEMESEIEKEREQIRKRYGG 160 >SB_32685| Best HMM Match : RCSD (HMM E-Value=0.18) Length = 530 Score = 27.5 bits (58), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 275 QRWECCHSIPGPPPY 231 QRW+ C P PPPY Sbjct: 33 QRWKVCKREPKPPPY 47 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,964,317 Number of Sequences: 59808 Number of extensions: 214039 Number of successful extensions: 274 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 267 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 274 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 789494848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -