BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00296 (775 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51842| Best HMM Match : YTH (HMM E-Value=1.8) 52 5e-07 SB_59353| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_37669| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_24312| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_17433| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_1285| Best HMM Match : SET (HMM E-Value=0.011) 39 0.005 SB_42189| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_22143| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_53723| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_30693| Best HMM Match : Protamine_P1 (HMM E-Value=6.3) 36 0.048 SB_25778| Best HMM Match : COX17 (HMM E-Value=1.1) 34 0.11 SB_43915| Best HMM Match : Bombesin (HMM E-Value=4.9) 34 0.11 SB_50051| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_52495| Best HMM Match : AT_hook (HMM E-Value=4.6) 33 0.34 SB_31608| Best HMM Match : DUF298 (HMM E-Value=3.9) 33 0.34 SB_11956| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_6699| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_51752| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_45392| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.78 SB_19874| Best HMM Match : CBM_X (HMM E-Value=2.2) 31 1.0 SB_51971| Best HMM Match : rve (HMM E-Value=7.7e-31) 31 1.4 SB_26234| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011) 30 1.8 SB_49539| Best HMM Match : RVT_1 (HMM E-Value=1.8e-39) 29 4.2 SB_41311| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_402| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_3684| Best HMM Match : fn3 (HMM E-Value=8e-11) 29 5.5 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 29 5.5 SB_33346| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_44880| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_39863| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_22177| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=4.5e-11) 28 9.6 SB_16125| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_7524| Best HMM Match : V-ATPase_G (HMM E-Value=3.2) 28 9.6 >SB_51842| Best HMM Match : YTH (HMM E-Value=1.8) Length = 244 Score = 52.0 bits (119), Expect = 5e-07 Identities = 37/125 (29%), Positives = 63/125 (50%), Gaps = 18/125 (14%) Frame = -1 Query: 517 DGRKQSNIKWE-MPSHDDPLAIDYTVPCSGMKDIYVGLANANPIDYYDLFLTPNILEYIT 341 +G + +I+ E + + P++I P G K++ N +P+ +++LF P ++E I Sbjct: 37 EGHESEDIEDENLVINSSPISIPDFTPRCGPKNLP---GNLSPLSFFELFFNPEVIELIV 93 Query: 340 EQTNLYATQCILPSDSSAG---SRNHLW-------TPVTL----ALVG---WMGLVKLPS 212 +TN Y QC G +++ W P+T+ A +G MG+VKLPS Sbjct: 94 TETNKYVVQCNPDEFDDEGRKKAKDRDWFDKEGNIKPLTVEELKAFLGITIMMGIVKLPS 153 Query: 211 IKDYW 197 +KDYW Sbjct: 154 MKDYW 158 >SB_59353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 560 Score = 42.3 bits (95), Expect = 4e-04 Identities = 28/93 (30%), Positives = 50/93 (53%), Gaps = 2/93 (2%) Frame = -1 Query: 517 DGRKQSNIKWEMPSHDD-PLAI-DYTVPCSGMKDIYVGLANANPIDYYDLFLTPNILEYI 344 +G + +I+ E+ S + P++I D+T C G K++ N +P+ +++LF ++E I Sbjct: 37 EGHESEDIEDEIWSRNSSPISILDFTPRC-GPKNLP---GNLSPLSFFELFFNSEVIELI 92 Query: 343 TEQTNLYATQCILPSDSSAGSRNHLWTPVTLAL 245 +TN YA QC P + R L T + + L Sbjct: 93 VTETNKYAVQC-NPDEFDDEGRRKLRTRIDVKL 124 >SB_37669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 39.1 bits (87), Expect = 0.004 Identities = 24/97 (24%), Positives = 46/97 (47%), Gaps = 11/97 (11%) Frame = -1 Query: 403 NANPIDYYDLFLTPNILEYITEQTNLYATQCILPSDSSAG---SRNHLW-------TPVT 254 N +P+ +++LF ++E I +TN+YA QC G +++ W P+T Sbjct: 54 NLSPLSFFELFFKSEVIELIVTETNMYAVQCNTDEFDEEGRKKAKDANWFDKEGNIKPLT 113 Query: 253 L-ALVGWMGLVKLPSIKDYWRNHKLYGTRLH*KYREW 146 + L ++G+ + I D H+ Y T ++ +W Sbjct: 114 VEELKAFLGITIMMGIVDLSDQHRSYYTVSSRRHMKW 150 >SB_24312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 787 Score = 39.1 bits (87), Expect = 0.004 Identities = 24/83 (28%), Positives = 36/83 (43%), Gaps = 7/83 (8%) Frame = -1 Query: 406 ANANPIDYYDLFLTPNILEYITEQTNLYATQCILPSDSSAGSRNHLWTPVT-------LA 248 A +D++ LF T ++++ I+ TN YA I S A W +A Sbjct: 161 AMTRAVDFFQLFFTAHLVQQISANTNAYAYANIQQKQSYANEMG-AWNDTNPEEINRLIA 219 Query: 247 LVGWMGLVKLPSIKDYWRNHKLY 179 L+ + GLV + S YW LY Sbjct: 220 LILYCGLVNVSSFHRYWNTKTLY 242 >SB_17433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1924 Score = 38.7 bits (86), Expect = 0.005 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = -1 Query: 403 NANPIDYYDLFLTPNILEYITEQTNLYATQ 314 N + + Y+++F TP ++E I +QTNLYA Q Sbjct: 1502 NDSELGYFEVFFTPELMEIIVDQTNLYAAQ 1531 >SB_1285| Best HMM Match : SET (HMM E-Value=0.011) Length = 829 Score = 38.7 bits (86), Expect = 0.005 Identities = 24/83 (28%), Positives = 36/83 (43%), Gaps = 7/83 (8%) Frame = -1 Query: 406 ANANPIDYYDLFLTPNILEYITEQTNLYATQCILPSDSSAGSRNHLWTPVT-------LA 248 A +D++ LF T ++++ I+ TN YA I S A W +A Sbjct: 161 AMTRAVDFFQLFFTAHLVQQISANTNAYAYANIEQKQSYANEMG-AWNDTNPEEINRLIA 219 Query: 247 LVGWMGLVKLPSIKDYWRNHKLY 179 L+ + GLV + S YW LY Sbjct: 220 LILYCGLVNVSSFHRYWNTKTLY 242 >SB_42189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 493 Score = 35.9 bits (79), Expect = 0.036 Identities = 24/83 (28%), Positives = 39/83 (46%), Gaps = 7/83 (8%) Frame = -1 Query: 403 NANPIDYYDLFLTPNILEYITEQTNLYATQCILPSDSSAGSRNHLWTPVT-------LAL 245 +A DY+ L + ++ I+++TN YA Q I+ + +R W VT L + Sbjct: 126 DAKAEDYFSLMFSDELIGLISDETNRYA-QFIIGQKADREARLAKWKDVTPDELRMFLGV 184 Query: 244 VGWMGLVKLPSIKDYWRNHKLYG 176 MG+ LP YW + L+G Sbjct: 185 ALVMGINSLPQQALYWSQNPLFG 207 >SB_22143| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1995 Score = 35.9 bits (79), Expect = 0.036 Identities = 24/83 (28%), Positives = 39/83 (46%), Gaps = 7/83 (8%) Frame = -1 Query: 403 NANPIDYYDLFLTPNILEYITEQTNLYATQCILPSDSSAGSRNHLWTPVT-------LAL 245 +A DY+ L + ++ I+++TN YA Q I+ + +R W VT L + Sbjct: 1870 DAKAEDYFSLMFSDELIGLISDETNRYA-QFIIGQKADREARLAKWKDVTPDELRMFLGV 1928 Query: 244 VGWMGLVKLPSIKDYWRNHKLYG 176 MG+ LP YW + L+G Sbjct: 1929 ALVMGINSLPQQALYWSQNPLFG 1951 >SB_53723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 709 Score = 35.5 bits (78), Expect = 0.048 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 7/83 (8%) Frame = -1 Query: 403 NANPIDYYDLFLTPNILEYITEQTNLYATQCILPSDSSAGSRNHLWTPVT-------LAL 245 +A DY+ L + ++ I+++TN YA Q ++ + +R W VT L + Sbjct: 88 DAKAEDYFSLMFSDELIGLISDETNRYA-QFVIGQKADREARLAKWKDVTPDELRMFLGV 146 Query: 244 VGWMGLVKLPSIKDYWRNHKLYG 176 MG+ LP YW + L+G Sbjct: 147 ALVMGINSLPQQALYWSQNPLFG 169 >SB_30693| Best HMM Match : Protamine_P1 (HMM E-Value=6.3) Length = 250 Score = 35.5 bits (78), Expect = 0.048 Identities = 27/87 (31%), Positives = 41/87 (47%), Gaps = 13/87 (14%) Frame = -1 Query: 415 VGLANA------NPIDYYDLFLTPNILEYITEQTNLYATQCILPSDSSAGSRNHLWTPVT 254 VGLAN + ++Y++LF + + + TNL A + + G+ W P+T Sbjct: 103 VGLANRGQRREKSALEYFELFFDQEVWDCLVTMTNLNAER-----KGAKGTSGGQWKPIT 157 Query: 253 L----ALVGW---MGLVKLPSIKDYWR 194 A G MG+VKLP K YW+ Sbjct: 158 QDEMKAFFGLNIAMGIVKLPEAKMYWQ 184 >SB_25778| Best HMM Match : COX17 (HMM E-Value=1.1) Length = 567 Score = 34.3 bits (75), Expect = 0.11 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 7/83 (8%) Frame = -1 Query: 403 NANPIDYYDLFLTPNILEYITEQTNLYATQCILPSDSSAGSRNHLWTPVT-------LAL 245 +A DY+ L + ++ I+++TN YA + I+ + +R W VT L + Sbjct: 88 DAKAEDYFSLMFSDELIGLISDETNRYA-RFIIGQKADREARLAKWKDVTPDELRMFLGV 146 Query: 244 VGWMGLVKLPSIKDYWRNHKLYG 176 MG+ LP YW + L+G Sbjct: 147 ALVMGINSLPQQALYWSQNPLFG 169 >SB_43915| Best HMM Match : Bombesin (HMM E-Value=4.9) Length = 485 Score = 34.3 bits (75), Expect = 0.11 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 1/80 (1%) Frame = -1 Query: 406 ANANPIDYYDLFLTPNILEYITEQTNLYATQCILPSDSSAGSR-NHLWTPVTLALVGWMG 230 A AN D+ + P++++ I E+TN A Q +D + N + LA+ G Sbjct: 276 AEANATDFLEQLFPPDLIDLIVEETNRNARQ--KDADPTYWEPVNASDIKIYLAIRLLQG 333 Query: 229 LVKLPSIKDYWRNHKLYGTR 170 + +PS +DYW G + Sbjct: 334 IKSVPSERDYWATSPFLGVK 353 >SB_50051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 33.9 bits (74), Expect = 0.15 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 7/83 (8%) Frame = -1 Query: 403 NANPIDYYDLFLTPNILEYITEQTNLYATQCILPSDSSAGSRNHLWTPVT-------LAL 245 +A DY+ L + ++ I+++TN YA Q I+ + +R W VT L + Sbjct: 88 DAKAEDYFSLMFSDELIGLISDKTNRYA-QFIIGQKADREARLAKWKDVTPDELRMFLGV 146 Query: 244 VGWMGLVKLPSIKDYWRNHKLYG 176 +G+ LP YW + L+G Sbjct: 147 ALVIGINSLPQQALYWSQNPLFG 169 >SB_52495| Best HMM Match : AT_hook (HMM E-Value=4.6) Length = 183 Score = 32.7 bits (71), Expect = 0.34 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 253 LALVGWMGLVKLPSIKDYW 197 L +V MG+VKLPS++DYW Sbjct: 47 LGIVIMMGIVKLPSVRDYW 65 >SB_31608| Best HMM Match : DUF298 (HMM E-Value=3.9) Length = 203 Score = 32.7 bits (71), Expect = 0.34 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 253 LALVGWMGLVKLPSIKDYW 197 L +V MG+VKLPS++DYW Sbjct: 67 LGIVIMMGIVKLPSVRDYW 85 >SB_11956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 832 Score = 32.7 bits (71), Expect = 0.34 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 253 LALVGWMGLVKLPSIKDYW 197 L +V MG+VKLPS++DYW Sbjct: 412 LGIVIMMGIVKLPSVRDYW 430 >SB_6699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1087 Score = 32.7 bits (71), Expect = 0.34 Identities = 17/51 (33%), Positives = 28/51 (54%) Frame = -2 Query: 651 SDIHPLPEIERRRSSRTAPVDLELQPPNVPSTSGNTDAQISEQEWMEENSP 499 SD+ P + RR S +++ P PS++ N+D + ++QEW E SP Sbjct: 686 SDLRGDPRYDSRRRS-------DVRSPERPSSARNSDTKATDQEWKEVRSP 729 >SB_51752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.7 bits (71), Expect = 0.34 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 253 LALVGWMGLVKLPSIKDYW 197 L +V MG+VKLPS++DYW Sbjct: 47 LGIVIMMGIVKLPSVRDYW 65 >SB_45392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 31.5 bits (68), Expect = 0.78 Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 7/73 (9%) Frame = -1 Query: 517 DGRKQSNI-KWEMPSHDDP---LAIDYTVPCSGMKDIYVGL---ANANPIDYYDLFLTPN 359 DG + S++ W +PSH A++ G+ + V L A +D++ LF T + Sbjct: 43 DGEEASSVGSWLLPSHSKQPPTTAMEMLTKIPGLL-LEVPLLRGAMTRAVDFFQLFFTAH 101 Query: 358 ILEYITEQTNLYA 320 +++ I+ TN YA Sbjct: 102 LVQQISANTNAYA 114 >SB_19874| Best HMM Match : CBM_X (HMM E-Value=2.2) Length = 725 Score = 31.1 bits (67), Expect = 1.0 Identities = 21/82 (25%), Positives = 39/82 (47%), Gaps = 3/82 (3%) Frame = -1 Query: 406 ANANPIDYYDLFLTPNILEYITEQTNLYATQCI-LPSDSS--AGSRNHLWTPVTLALVGW 236 A A +D++ L T IL I +TN A Q + + SD A +++ L + + Sbjct: 92 AEAGALDFFKLLFTDEILGEIVLETNRNAAQKMRIASDPKWYATTKDELCAYFGIRFL-- 149 Query: 235 MGLVKLPSIKDYWRNHKLYGTR 170 G++ +PS + YW ++ + Sbjct: 150 QGIISVPSERHYWSKNEFLSVK 171 >SB_51971| Best HMM Match : rve (HMM E-Value=7.7e-31) Length = 488 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -2 Query: 654 DSDIHPLPEIERRRSSRTAPVDLELQPPNVPST 556 + ++ PLPE+ + S P PP+VPST Sbjct: 438 EPEVTPLPEVSPKSSETVVPTCTTESPPDVPST 470 >SB_26234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 368 Score = 30.3 bits (65), Expect = 1.8 Identities = 36/125 (28%), Positives = 55/125 (44%), Gaps = 18/125 (14%) Frame = -1 Query: 517 DGRKQSNIKWEMPSHDD-PLAIDYTVPCSGMKDIYVGLANANPIDYYDLFLTPNILEYIT 341 +G +I+ E+ S + P++I P G K++ N +P+ + ++E I Sbjct: 37 EGHDSEDIEDEIWSRNSLPISIPDFTPRCGPKNLP---GNLSPL------FSLKVIELIV 87 Query: 340 EQTNLYATQCILPSDSSAGSR-----NHL-----WTPVT-------LALVGWMGLVKLPS 212 +TN YA QC G + N L P+T L + MG+VKLPS Sbjct: 88 TETNKYAVQCNPDKFDDEGRKKAKDVNCLDKEGNIKPLTVEELKTFLGITIMMGIVKLPS 147 Query: 211 IKDYW 197 KDYW Sbjct: 148 KKDYW 152 >SB_3433| Best HMM Match : Actin (HMM E-Value=0.00011) Length = 580 Score = 30.3 bits (65), Expect = 1.8 Identities = 24/84 (28%), Positives = 38/84 (45%) Frame = -1 Query: 280 RNHLWTPVTLALVGWMGLVKLPSIKDYWRNHKLYGTRLH*KYREWNISTVPLILKSF*LK 101 R +L + + V W+ K + + K TRLH W + +ILKSF L Sbjct: 74 RQNLSVAICQSSVRWLCAFK--RVCRFVSTDKADKTRLH-VCAIWRQTARVVILKSFTLA 130 Query: 100 TPWF*KSNTIYLFKKRFSVLSRGF 29 PW ++ ++ + FS +RGF Sbjct: 131 LPWRPEAPRVFQANRDFSSETRGF 154 >SB_49539| Best HMM Match : RVT_1 (HMM E-Value=1.8e-39) Length = 1311 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -2 Query: 654 DSDIHPLPEIERRRSSRTAPVDLELQPPNVPST 556 + ++ PLPE+ + S AP PP+V ST Sbjct: 1125 EPEVTPLPEVSPKSSETVAPTCTTESPPDVAST 1157 >SB_41311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 753 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -1 Query: 253 LALVGWMGLVKLPSIKDYW 197 L++ MG+VK PS+KDYW Sbjct: 150 LSITIMMGIVKPPSMKDYW 168 >SB_402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 730 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = -2 Query: 660 FSDSDIHPLPEIERRRSSRTAPVDLELQPPNVPSTSGNTDAQ 535 F+D L +E+++S + A + +P N PST T Q Sbjct: 534 FADDPFSGLSNVEQKKSDKLARSKRQQKPVNKPSTEAGTKTQ 575 >SB_3684| Best HMM Match : fn3 (HMM E-Value=8e-11) Length = 862 Score = 28.7 bits (61), Expect = 5.5 Identities = 15/29 (51%), Positives = 18/29 (62%), Gaps = 3/29 (10%) Frame = -1 Query: 508 KQSNIKWEMPSHDDPLAI-DYTV--PCSG 431 K +KW +PS DPLA+ DY V CSG Sbjct: 284 KTLKLKWAVPSSVDPLAVKDYLVSWTCSG 312 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 28.7 bits (61), Expect = 5.5 Identities = 24/71 (33%), Positives = 32/71 (45%), Gaps = 3/71 (4%) Frame = -2 Query: 687 PRISRRLSTFSD-SDIHPLPEIER-RRSSRTAPVDLELQPPNVPS-TSGNTDAQISEQEW 517 PR STF D S + P E R S+R PN S S +T+ I+EQ+ Sbjct: 200 PRSPMSPSTFVDLSQVMPSMEAGMTRNSARMRNESGRFSNPNTNSGNSSDTEEPITEQQG 259 Query: 516 MEENSPT*NGK 484 EN + NG+ Sbjct: 260 STENQTSNNGR 270 >SB_33346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1074 Score = 28.3 bits (60), Expect = 7.3 Identities = 18/67 (26%), Positives = 36/67 (53%) Frame = -2 Query: 705 SQIWNPPRISRRLSTFSDSDIHPLPEIERRRSSRTAPVDLELQPPNVPSTSGNTDAQISE 526 S I PP+++ ++ T +S + L +R SS + L+ PP+VP S + +IS Sbjct: 852 SAIAKPPQLTSKIQT-PNSYLGTLSTATKRASSISTKT-LKRTPPSVPVRSSSRATKISY 909 Query: 525 QEWMEEN 505 + +++ + Sbjct: 910 KAYLQSD 916 >SB_44880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 758 Score = 27.9 bits (59), Expect = 9.6 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -3 Query: 695 GTLLGFQGVCQHFRIVIYIHC 633 G ++GF GVC + + +Y++C Sbjct: 728 GRIMGFLGVCSIYYVFMYVNC 748 >SB_39863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2978 Score = 27.9 bits (59), Expect = 9.6 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 240 PTRAKVTGVHRWFLDPAEESEG 305 PTR G+ W LDPA+ + G Sbjct: 2831 PTRVAFVGISNWSLDPAKMNRG 2852 >SB_22177| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=4.5e-11) Length = 1170 Score = 27.9 bits (59), Expect = 9.6 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 7/68 (10%) Frame = -1 Query: 358 ILEYITEQTNLYATQCILPSDSSAGSRNHLWTPVT-------LALVGWMGLVKLPSIKDY 200 ++ I+++TN YA Q I+ ++ +R W VT L + MG+ LP Y Sbjct: 6 LIGLISDETNRYA-QFIIGQKANREARLAKWKDVTPDELRMFLGVALVMGINSLPQQALY 64 Query: 199 WRNHKLYG 176 W + L+G Sbjct: 65 WSQNPLFG 72 >SB_16125| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 27.9 bits (59), Expect = 9.6 Identities = 12/40 (30%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = +2 Query: 578 WSSKSTGAVLDDLRRSISGNGC-ISLSENVDKRLEILGGF 694 ++S+ + V+DD+ +S NGC + L ++++ ++L GF Sbjct: 119 FTSRFSLDVIDDVSLQLSHNGCYLDLENTLEEQADLLEGF 158 >SB_7524| Best HMM Match : V-ATPase_G (HMM E-Value=3.2) Length = 492 Score = 27.9 bits (59), Expect = 9.6 Identities = 21/82 (25%), Positives = 37/82 (45%), Gaps = 3/82 (3%) Frame = -1 Query: 406 ANANPIDYYDLFLTPNILEYITEQTNLYATQ-CILPSDSS--AGSRNHLWTPVTLALVGW 236 A A +D++ L T I E I +TN A Q + SD A +++ L + + Sbjct: 280 AEAGALDFFKLLFTDEIPEEIVLETNRNAAQKTRIVSDPKWYATTKDELCAYFGIRFL-- 337 Query: 235 MGLVKLPSIKDYWRNHKLYGTR 170 G+ +PS + YW ++ + Sbjct: 338 QGIKSVPSERHYWSKNEFLSVK 359 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,152,621 Number of Sequences: 59808 Number of extensions: 558436 Number of successful extensions: 1194 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 1084 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1180 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2107953584 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -