BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00296 (775 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY118323-1|AAM48352.1| 1843|Drosophila melanogaster LD10526p pro... 33 0.44 AE014298-2899|AAF48990.3| 2006|Drosophila melanogaster CG12238-P... 33 0.44 AE014134-1403|AAF52603.3| 1675|Drosophila melanogaster CG8683-PA... 32 1.0 BT010042-1|AAQ22511.1| 2045|Drosophila melanogaster LD36052p pro... 29 9.4 AF157066-1|AAD43129.1| 2262|Drosophila melanogaster klarsicht pr... 29 9.4 AE014296-105|AAF47389.1| 2262|Drosophila melanogaster CG17046-PA... 29 9.4 AE014296-104|ABI31227.1| 2045|Drosophila melanogaster CG17046-PB... 29 9.4 >AY118323-1|AAM48352.1| 1843|Drosophila melanogaster LD10526p protein. Length = 1843 Score = 33.1 bits (72), Expect = 0.44 Identities = 13/42 (30%), Positives = 26/42 (61%) Frame = -2 Query: 690 PPRISRRLSTFSDSDIHPLPEIERRRSSRTAPVDLELQPPNV 565 P R +RR +T +++++ P P+ R+R S+ + +L PP + Sbjct: 809 PLRATRRTTTSTNTNLQPTPKSTRKRQSKASVQQSQLPPPTM 850 >AE014298-2899|AAF48990.3| 2006|Drosophila melanogaster CG12238-PA protein. Length = 2006 Score = 33.1 bits (72), Expect = 0.44 Identities = 13/42 (30%), Positives = 26/42 (61%) Frame = -2 Query: 690 PPRISRRLSTFSDSDIHPLPEIERRRSSRTAPVDLELQPPNV 565 P R +RR +T +++++ P P+ R+R S+ + +L PP + Sbjct: 972 PLRATRRTTTSTNTNLQPTPKSTRKRQSKASVQQSQLPPPTM 1013 >AE014134-1403|AAF52603.3| 1675|Drosophila melanogaster CG8683-PA protein. Length = 1675 Score = 31.9 bits (69), Expect = 1.0 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 7/53 (13%) Frame = -1 Query: 232 GLVKLPSIKDYWR---NHKL-YGTRLH*KYREWNISTVPLILKS---F*LKTP 95 GLV +P IK WR NH L H + REW + + ++KS F KTP Sbjct: 771 GLVNMPRIKVLWRPLTNHLLEVCQHRHIRMREWGVEAITYLVKSALQFKHKTP 823 >BT010042-1|AAQ22511.1| 2045|Drosophila melanogaster LD36052p protein. Length = 2045 Score = 28.7 bits (61), Expect = 9.4 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = -2 Query: 624 ERRRSSRTAPVDLELQPPNVPSTSGNTDAQISEQE 520 ERRRSSR ++L P S+SG +D++ EQE Sbjct: 1411 ERRRSSRNLEKCIKLIPATTSSSSG-SDSEDGEQE 1444 >AF157066-1|AAD43129.1| 2262|Drosophila melanogaster klarsicht protein protein. Length = 2262 Score = 28.7 bits (61), Expect = 9.4 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = -2 Query: 624 ERRRSSRTAPVDLELQPPNVPSTSGNTDAQISEQE 520 ERRRSSR ++L P S+SG +D++ EQE Sbjct: 1628 ERRRSSRNLEKCIKLIPATTSSSSG-SDSEDGEQE 1661 >AE014296-105|AAF47389.1| 2262|Drosophila melanogaster CG17046-PA, isoform A protein. Length = 2262 Score = 28.7 bits (61), Expect = 9.4 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = -2 Query: 624 ERRRSSRTAPVDLELQPPNVPSTSGNTDAQISEQE 520 ERRRSSR ++L P S+SG +D++ EQE Sbjct: 1628 ERRRSSRNLEKCIKLIPATTSSSSG-SDSEDGEQE 1661 >AE014296-104|ABI31227.1| 2045|Drosophila melanogaster CG17046-PB, isoform B protein. Length = 2045 Score = 28.7 bits (61), Expect = 9.4 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = -2 Query: 624 ERRRSSRTAPVDLELQPPNVPSTSGNTDAQISEQE 520 ERRRSSR ++L P S+SG +D++ EQE Sbjct: 1411 ERRRSSRNLEKCIKLIPATTSSSSG-SDSEDGEQE 1444 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 36,267,305 Number of Sequences: 53049 Number of extensions: 807931 Number of successful extensions: 2024 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1889 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2024 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3581842374 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -