BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00295 (392 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1026 + 30214437-30214937 136 8e-33 02_05_0416 + 28791512-28792012 132 1e-31 11_04_0079 - 13284869-13284929,13285518-13285639,13285749-132858... 30 0.76 06_01_0796 - 5932794-5934212,5934955-5935013,5936324-5936414 29 1.0 04_01_0314 - 4243928-4244361,4245178-4245415 29 1.3 03_06_0776 - 36176390-36177589 29 1.8 08_01_0619 + 5412058-5413224,5413357-5413476,5413755-5413831,541... 28 3.1 12_01_0613 + 5060150-5060320,5062255-5062359,5064057-5064143,506... 27 4.1 07_03_0574 - 19629875-19631032 27 4.1 02_01_0428 - 3127098-3129254 27 4.1 07_01_1116 + 10308029-10308111,10308575-10308737,10308996-103090... 27 5.4 03_06_0499 - 34354040-34354528 27 5.4 02_01_0417 - 3048519-3048710,3048903-3050600,3050622-3050909,305... 27 7.1 11_06_0546 + 24853167-24853880 26 9.4 05_01_0358 + 2808627-2809847 26 9.4 03_05_0131 - 21107865-21108085,21108517-21108766,21110310-211105... 26 9.4 02_03_0235 - 16702768-16702956,16703956-16704492,16705084-167052... 26 9.4 >04_04_1026 + 30214437-30214937 Length = 166 Score = 136 bits (328), Expect = 8e-33 Identities = 65/88 (73%), Positives = 81/88 (92%), Gaps = 1/88 (1%) Frame = +1 Query: 1 AKATS-DWKGLKITVQLTVQNRQAQIAVVPSAAALIIRALKEPPRDRKKQKNIKHNGNIS 177 AK T+ DWKGL++TV+LTVQNRQA+++VVPSAAAL+I+ALKEP RDRKK KNIKH+GNIS Sbjct: 47 AKETAKDWKGLRVTVKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHSGNIS 106 Query: 178 LEDVIGIAKIMRNRSMARYLSGSVKEFL 261 L+DVI IA+IMRNRSMA+ ++G+VKE L Sbjct: 107 LDDVIEIARIMRNRSMAKEMAGTVKEIL 134 Score = 39.9 bits (89), Expect = 7e-04 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = +3 Query: 249 KRILGTAQSVGCTVEGRPPHDLIDDINSG 335 K ILGT SVGCTV+G+ P DL +I+ G Sbjct: 131 KEILGTCVSVGCTVDGKDPKDLQQEISDG 159 >02_05_0416 + 28791512-28792012 Length = 166 Score = 132 bits (319), Expect = 1e-31 Identities = 63/88 (71%), Positives = 80/88 (90%), Gaps = 1/88 (1%) Frame = +1 Query: 1 AKATS-DWKGLKITVQLTVQNRQAQIAVVPSAAALIIRALKEPPRDRKKQKNIKHNGNIS 177 AK T+ DWKGL++TV+LTVQNRQA+++VVPSAAAL+I+ALKEP RDRKK KNIKH+GNIS Sbjct: 47 AKETAKDWKGLRVTVKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHSGNIS 106 Query: 178 LEDVIGIAKIMRNRSMARYLSGSVKEFL 261 L+DVI IA++MR RSMA+ ++G+VKE L Sbjct: 107 LDDVIEIARVMRPRSMAKEMAGTVKEIL 134 Score = 39.9 bits (89), Expect = 7e-04 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = +3 Query: 249 KRILGTAQSVGCTVEGRPPHDLIDDINSG 335 K ILGT SVGCTV+G+ P DL +I+ G Sbjct: 131 KEILGTCVSVGCTVDGKDPKDLQQEISDG 159 >11_04_0079 - 13284869-13284929,13285518-13285639,13285749-13285820, 13286048-13286200,13289510-13289709,13289745-13289947, 13289991-13290181 Length = 333 Score = 29.9 bits (64), Expect = 0.76 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -2 Query: 340 QTPLLMSSIRSCGGLPSTVHPTDCAVPRI 254 Q PL S+RSCG L + P + ++PR+ Sbjct: 120 QAPLSPKSVRSCGPLKLVIEPYNGSLPRL 148 >06_01_0796 - 5932794-5934212,5934955-5935013,5936324-5936414 Length = 522 Score = 29.5 bits (63), Expect = 1.0 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +1 Query: 19 WKGLKITVQLTVQNRQAQIAVVPSAAALIIRALKEPPRDRKKQ 147 W + V V + + V+P+A A +IRA+ + P R++Q Sbjct: 33 WYSYLVDVDADVDDDMISLRVLPNARAALIRAVADAPGRREEQ 75 >04_01_0314 - 4243928-4244361,4245178-4245415 Length = 223 Score = 29.1 bits (62), Expect = 1.3 Identities = 21/89 (23%), Positives = 39/89 (43%), Gaps = 2/89 (2%) Frame = +1 Query: 73 IAVVPSAAALIIR--ALKEPPRDRKKQKNIKHNGNISLEDVIGIAKIMRNRSMARYLSGS 246 + +V S IIR + E +K ++HN S V+G+ ++NRS YL+ Sbjct: 85 VLLVSSILLAIIRLICISEINNPQKSVSKLRHNTTTSRTIVVGLTTSLKNRS---YLNSP 141 Query: 247 VKEFLAQHSQLDVLWRAGRHMILLMTSTA 333 + H ++ R R + + ++A Sbjct: 142 KNQVNQSHEHIEWSLRKARALWRMSNASA 170 >03_06_0776 - 36176390-36177589 Length = 399 Score = 28.7 bits (61), Expect = 1.8 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = +1 Query: 145 QKNIKHNGNISLEDVIGIAKIMRNRSMARY 234 +K+I++ G++ LE + K+M +RSM RY Sbjct: 113 EKSIQNIGSLELERNAAVEKLMSSRSMHRY 142 >08_01_0619 + 5412058-5413224,5413357-5413476,5413755-5413831, 5414201-5414321 Length = 494 Score = 27.9 bits (59), Expect = 3.1 Identities = 16/65 (24%), Positives = 28/65 (43%) Frame = +1 Query: 118 KEPPRDRKKQKNIKHNGNISLEDVIGIAKIMRNRSMARYLSGSVKEFLAQHSQLDVLWRA 297 K D +K K GN+ E + + +I++ R+ L G V E ++ LW Sbjct: 291 KREMSDEEKHKLRVEIGNLPEEKMGNVLQIVQKRNTDPALMGEVVELDFDEMDVETLWEL 350 Query: 298 GRHMI 312 R ++ Sbjct: 351 DRFVV 355 >12_01_0613 + 5060150-5060320,5062255-5062359,5064057-5064143, 5064265-5064318,5064402-5064547,5064651-5064804, 5064891-5065028,5065454-5065527,5065615-5065756, 5066396-5066474,5067326-5067423 Length = 415 Score = 27.5 bits (58), Expect = 4.1 Identities = 18/58 (31%), Positives = 32/58 (55%) Frame = +1 Query: 100 LIIRALKEPPRDRKKQKNIKHNGNISLEDVIGIAKIMRNRSMARYLSGSVKEFLAQHS 273 LI RALK P +++ ++HN I++E ++K+M + + YL V ++ HS Sbjct: 270 LIARALKGPLAPSQQEDLVEHNPLIAVEI---LSKLMNSPDIDGYLDVLVHMEMSLHS 324 >07_03_0574 - 19629875-19631032 Length = 385 Score = 27.5 bits (58), Expect = 4.1 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -1 Query: 197 IPITSSREMLPLCLIFFCFLRSRG-GSLRALMIRAAAEGTTAIW 69 +P E++P C ++F F R+ G SL A + AA +W Sbjct: 247 LPFAGKAELVPGCNLWFGFSRADGSSSLCAADLAAAPHRACGVW 290 >02_01_0428 - 3127098-3129254 Length = 718 Score = 27.5 bits (58), Expect = 4.1 Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 3/48 (6%) Frame = +1 Query: 151 NIKHN---GNISLEDVIGIAKIMRNRSMARYLSGSVKEFLAQHSQLDV 285 N+ HN G + LE+++ ++ +LSG+++EF AQ S+ + Sbjct: 94 NLSHNLLSGELPLEELVSSTSLVILDISFNHLSGALQEFSAQISETTI 141 >07_01_1116 + 10308029-10308111,10308575-10308737,10308996-10309062, 10309120-10309375,10309658-10309781,10310039-10310077 Length = 243 Score = 27.1 bits (57), Expect = 5.4 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = -3 Query: 105 DKGCCRGNNSYLGL-SVLNCQLHSD 34 D GCC SYLGL +L C++++D Sbjct: 62 DCGCCYALPSYLGLFHILICKVYAD 86 >03_06_0499 - 34354040-34354528 Length = 162 Score = 27.1 bits (57), Expect = 5.4 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = -1 Query: 230 RAIDLFLMIFA-IPITSSREMLPLCLIFFCFLRSRGGSLRALMIRAAAEGTTAIWACLF* 54 R I+ +L+ ++ + S ++ L FF RGG R+L AA+G A W C Sbjct: 47 RGIERYLLSWSDFLLGSGAKLKEKYLGFFSGEGERGGEARSL----AAKGAAAAWPCCDN 102 Query: 53 TVSCTVILRP 24 CT + P Sbjct: 103 CGGCTKSIPP 112 >02_01_0417 - 3048519-3048710,3048903-3050600,3050622-3050909, 3052308-3052377,3052417-3052668,3053235-3055297 Length = 1520 Score = 26.6 bits (56), Expect = 7.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 207 HEKQINGPVPFWLS 248 H Q+NGP+P W S Sbjct: 481 HNNQLNGPIPTWTS 494 >11_06_0546 + 24853167-24853880 Length = 237 Score = 26.2 bits (55), Expect = 9.4 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = -2 Query: 361 KHLFINGQTPLLMSSIRSCGGLPS-TVHPTDCAVPRILLLSQK 236 KHL +NG LL+SS+ + + T+H T + +L++K Sbjct: 38 KHLELNGNKSLLLSSLENAKNISKVTLHSTWLDRANLQILAKK 80 >05_01_0358 + 2808627-2809847 Length = 406 Score = 26.2 bits (55), Expect = 9.4 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -1 Query: 146 CFLRSRGGSLRALMIRAAAEGTTAIWACLF 57 C L +G SLRA + AAA+G + A L+ Sbjct: 249 CELSRQGRSLRAAHVVAAADGVDLLLAVLY 278 >03_05_0131 - 21107865-21108085,21108517-21108766,21110310-21110549, 21111104-21111234,21114107-21114365 Length = 366 Score = 26.2 bits (55), Expect = 9.4 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = -2 Query: 286 VHPTDCAVPRILLLSQKGTGPLI 218 VHPT AV +++ ++ G+ PL+ Sbjct: 333 VHPTQAAVEKLMKIAFDGSAPLV 355 >02_03_0235 - 16702768-16702956,16703956-16704492,16705084-16705233, 16705310-16705625,16707005-16707286,16707895-16707971, 16708121-16708186,16708700-16709246,16709435-16709565, 16709642-16709746,16709859-16710039,16710123-16710185, 16711000-16711109,16711576-16711638,16711859-16712191 Length = 1049 Score = 26.2 bits (55), Expect = 9.4 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -3 Query: 108 DDKGCCRGNNSYL 70 +DKGCC+G N +L Sbjct: 719 EDKGCCKGLNEFL 731 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,053,880 Number of Sequences: 37544 Number of extensions: 223215 Number of successful extensions: 646 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 628 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 646 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 672845152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -