BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00293 (748 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_07_0227 + 42144437-42144446,42145059-42145428,42145528-421456... 30 2.2 07_03_1242 + 25113464-25114150 28 6.9 01_03_0278 - 14509481-14509506,14510700-14512291,14512547-145126... 28 9.1 >01_07_0227 + 42144437-42144446,42145059-42145428,42145528-42145649, 42145767-42145935,42146236-42146545,42146742-42146825, 42147012-42147083,42147780-42147821,42147931-42148020, 42148106-42148213,42148292-42148384,42148540-42148619, 42148701-42148953,42151222-42151236 Length = 605 Score = 29.9 bits (64), Expect = 2.2 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 107 CYIREFDGVLPFDSVTYSKEAECTRYFCAH 196 C I+ + +L + SK A+C RYFC H Sbjct: 182 CLIKMLEEILERAAEISSKLAQCDRYFCGH 211 >07_03_1242 + 25113464-25114150 Length = 228 Score = 28.3 bits (60), Expect = 6.9 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +2 Query: 134 LPFDSVTYSKEAECTRYFCAHDAVIHQSCKDELGRDT 244 LP V Y C + C+ D IH++C D RDT Sbjct: 35 LPITGVGY----RCNHHHCS-DFTIHEACADRFARDT 66 >01_03_0278 - 14509481-14509506,14510700-14512291,14512547-14512638, 14513030-14514412 Length = 1030 Score = 27.9 bits (59), Expect = 9.1 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +2 Query: 2 SLKTLVFCVCVTLASAAIQRSALEPIPDKFSGLQGCYIRE 121 SL L C C +LAS+++ S P +S LQG I E Sbjct: 960 SLVKLTLCYCKSLASSSLPNS-----PQAYSSLQGLIIME 994 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,296,337 Number of Sequences: 37544 Number of extensions: 362238 Number of successful extensions: 812 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 790 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 812 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1980691104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -