BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00290 (769 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z79754-10|CAB02099.1| 181|Caenorhabditis elegans Hypothetical p... 77 1e-14 AF101316-3|AAC69232.2| 508|Caenorhabditis elegans Hypothetical ... 29 2.8 Z81054-12|CAB61006.1| 1781|Caenorhabditis elegans Hypothetical p... 29 4.8 Z81032-6|CAB60991.1| 1781|Caenorhabditis elegans Hypothetical pr... 29 4.8 AY130758-2|AAN61518.1| 18519|Caenorhabditis elegans 2MDa_2 prote... 29 4.8 AY130758-1|AAN61517.1| 18534|Caenorhabditis elegans 2MDa_1 prote... 29 4.8 AF038576-1|AAC38973.1| 1781|Caenorhabditis elegans CED-5 protein. 29 4.8 Z48544-2|CAA88437.1| 766|Caenorhabditis elegans Hypothetical pr... 28 6.4 U40958-3|ABQ13075.1| 219|Caenorhabditis elegans Hypothetical pr... 28 6.4 Z48582-8|CAB70201.1| 3178|Caenorhabditis elegans Hypothetical pr... 28 8.4 Z48544-10|CAB70192.1| 3178|Caenorhabditis elegans Hypothetical p... 28 8.4 >Z79754-10|CAB02099.1| 181|Caenorhabditis elegans Hypothetical protein F25H2.11 protein. Length = 181 Score = 77.0 bits (181), Expect = 1e-14 Identities = 36/68 (52%), Positives = 49/68 (72%), Gaps = 2/68 (2%) Frame = +2 Query: 59 MKIYKDIITGDEMFSDTYKMKLVDEVIYEVTGRLVTRAQGDIQIEGFNPSAEEA--DEGT 232 M IYKDI T DE+ SD++ MKLVD+++YE G+ V R +G+I + G NPSAEE D+G+ Sbjct: 1 MLIYKDIFTDDELSSDSFPMKLVDDLVYEFKGKHVVRKEGEIVLAGSNPSAEEGAEDDGS 60 Query: 233 DSAVESGV 256 D VE G+ Sbjct: 61 DEHVERGI 68 Score = 56.8 bits (131), Expect = 2e-08 Identities = 34/91 (37%), Positives = 51/91 (56%), Gaps = 7/91 (7%) Frame = +1 Query: 256 DIVLNHRLVETYAFGDKKSYTLYLKDYMKKLVAKLEEKAPDQ--VEVFKTNMNKVMKDIL 429 DIVLNH+LVE + D + Y+K +MK ++ +E+ D+ V+ FK + + +L Sbjct: 69 DIVLNHKLVEMNCYEDASMFKAYIKKFMKNVIDHMEKNNRDKADVDAFKKKIQGWVVSLL 128 Query: 430 G--RFKELQFFTGESM---DCDGMVAMMEYR 507 RFK L FF GE +G VA++EYR Sbjct: 129 AKDRFKNLAFFIGERAAEGAENGQVAIIEYR 159 >AF101316-3|AAC69232.2| 508|Caenorhabditis elegans Hypothetical protein F52F10.2 protein. Length = 508 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 411 FVHVCFKYFNLVRRLLFQFCY*FFHI 334 F+++C +Y RR L FCY F I Sbjct: 137 FIYLCIEYLPTGRRYLMMFCYILFDI 162 >Z81054-12|CAB61006.1| 1781|Caenorhabditis elegans Hypothetical protein C02F4.1 protein. Length = 1781 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +1 Query: 304 KKSYTLYLKDYMKKLVAKLEEK 369 +K+Y YL+++MK LVA + EK Sbjct: 754 EKTYKQYLREFMKSLVALMSEK 775 >Z81032-6|CAB60991.1| 1781|Caenorhabditis elegans Hypothetical protein C02F4.1 protein. Length = 1781 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +1 Query: 304 KKSYTLYLKDYMKKLVAKLEEK 369 +K+Y YL+++MK LVA + EK Sbjct: 754 EKTYKQYLREFMKSLVALMSEK 775 >AY130758-2|AAN61518.1| 18519|Caenorhabditis elegans 2MDa_2 protein protein. Length = 18519 Score = 28.7 bits (61), Expect = 4.8 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = +1 Query: 286 TYAFG--DKKSYTLYLKDYMKKLVAKLEEKAPDQVEVFKTNMNKVMKDILGRFKELQ 450 T+ FG D++ Y++ +KD KKL + E+ + TN K + G+ K L+ Sbjct: 11103 TFNFGQKDQEQYSMVMKDVSKKLARQNAEEIQSGKLIPTTNEEKTGLALTGKNKNLK 11159 >AY130758-1|AAN61517.1| 18534|Caenorhabditis elegans 2MDa_1 protein protein. Length = 18534 Score = 28.7 bits (61), Expect = 4.8 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = +1 Query: 286 TYAFG--DKKSYTLYLKDYMKKLVAKLEEKAPDQVEVFKTNMNKVMKDILGRFKELQ 450 T+ FG D++ Y++ +KD KKL + E+ + TN K + G+ K L+ Sbjct: 11103 TFNFGQKDQEQYSMVMKDVSKKLARQNAEEIQSGKLIPTTNEEKTGLALTGKNKNLK 11159 >AF038576-1|AAC38973.1| 1781|Caenorhabditis elegans CED-5 protein. Length = 1781 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +1 Query: 304 KKSYTLYLKDYMKKLVAKLEEK 369 +K+Y YL+++MK LVA + EK Sbjct: 754 EKTYKQYLREFMKSLVALMSEK 775 >Z48544-2|CAA88437.1| 766|Caenorhabditis elegans Hypothetical protein ZK945.3 protein. Length = 766 Score = 28.3 bits (60), Expect = 6.4 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = +1 Query: 301 DKKSYTLYLKDYMKKLVAKLEEKAPDQVEVFKTNMNKVMKDILGRFKE 444 +KK+ L L +K + K+EEKA K+ ++K +KD L R K+ Sbjct: 22 EKKAKGLKLNKVDRKRIVKIEEKA-----ALKSKVDKAVKDELERLKK 64 >U40958-3|ABQ13075.1| 219|Caenorhabditis elegans Hypothetical protein F09F9.5 protein. Length = 219 Score = 28.3 bits (60), Expect = 6.4 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -2 Query: 363 FQFCY*FFHIVFEVQCVGFLVTEGVCF 283 +Q C+ F H+ +GF GVCF Sbjct: 53 YQTCFGFMHVKIATCSIGFFALLGVCF 79 >Z48582-8|CAB70201.1| 3178|Caenorhabditis elegans Hypothetical protein ZK945.9 protein. Length = 3178 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -1 Query: 349 LIFSYSL*GTMCRISCHRRRMFRLACGSGLCHSALDGRVRALVS 218 ++FSY L G + SC R+ R G+ + LD + A+VS Sbjct: 2939 IVFSYCLAGAVFFTSCKMIRILRFNRRIGVLAATLDNALGAIVS 2982 >Z48544-10|CAB70192.1| 3178|Caenorhabditis elegans Hypothetical protein ZK945.9 protein. Length = 3178 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -1 Query: 349 LIFSYSL*GTMCRISCHRRRMFRLACGSGLCHSALDGRVRALVS 218 ++FSY L G + SC R+ R G+ + LD + A+VS Sbjct: 2939 IVFSYCLAGAVFFTSCKMIRILRFNRRIGVLAATLDNALGAIVS 2982 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,653,988 Number of Sequences: 27780 Number of extensions: 339569 Number of successful extensions: 931 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 900 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 931 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1840614650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -