BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00288X (402 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0830 + 6261629-6261704,6261829-6261974,6262086-6262310,626... 27 7.3 >06_01_0830 + 6261629-6261704,6261829-6261974,6262086-6262310, 6262910-6263122,6264007-6264300 Length = 317 Score = 26.6 bits (56), Expect = 7.3 Identities = 13/58 (22%), Positives = 29/58 (50%) Frame = +1 Query: 148 PKIHSLLEHILL*TYIR*VLHQNIEKNDCFKFISCNRQSTAISTFARYNHEQKNPMIK 321 P++++ L H + H+ ++ + ++ ++ I+TF RYN E +P+ K Sbjct: 163 PEVNTKLAHSEAKILHEKIQHKAYGDDEIIRILTTRSKAQLIATFNRYNDEYGHPINK 220 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,304,413 Number of Sequences: 37544 Number of extensions: 159326 Number of successful extensions: 259 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 259 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 259 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 694697784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -