BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00288X (402 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ347149-1|CAC87548.1| 89|Homo sapiens immunoglobulin heavy ch... 30 3.3 AK097987-1|BAC05210.1| 132|Homo sapiens protein ( Homo sapiens ... 29 7.7 >AJ347149-1|CAC87548.1| 89|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 89 Score = 29.9 bits (64), Expect = 3.3 Identities = 17/57 (29%), Positives = 27/57 (47%) Frame = -2 Query: 287 RANVEIAVD*RLHEINLKQSFFSIF*CSTYLMYVYNSICSSKECIFG*TFLYVPSIW 117 ++ V I+VD ++ +LK S S+ T + Y CSS C G + Y +W Sbjct: 35 KSRVTISVDTSKNQFSLKLS--SVTAADTAVYYCARDSCSSTSCYTGLYYYYYMDVW 89 >AK097987-1|BAC05210.1| 132|Homo sapiens protein ( Homo sapiens cDNA FLJ40668 fis, clone THYMU2020830. ). Length = 132 Score = 28.7 bits (61), Expect = 7.7 Identities = 9/25 (36%), Positives = 19/25 (76%) Frame = -3 Query: 226 FFLYFDVVLI*CMFTIVYVLVKSVF 152 FFLYF+++ + C+F IV+ ++ ++ Sbjct: 108 FFLYFNLIPLKCLFFIVFFIIYIIY 132 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 53,744,290 Number of Sequences: 237096 Number of extensions: 948571 Number of successful extensions: 1203 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1188 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1203 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2928276690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -