BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00288X (402 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 23 0.99 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 23 1.7 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 23 1.7 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 6.9 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 20 9.2 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 23.4 bits (48), Expect = 0.99 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -2 Query: 200 YLMYVYNSICSSKECIFG*TFLYVPSIWKLTI 105 Y + +YN+ S + + TF+Y P K TI Sbjct: 208 YALIIYNNADDSFQRLTSSTFVYDPRYTKYTI 239 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 22.6 bits (46), Expect = 1.7 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = +1 Query: 325 WNIMTKSNTRFSYPENTGIVI 387 W I+ TRF YP+ +++ Sbjct: 645 WMIIEPPGTRFFYPDRKQVIL 665 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 22.6 bits (46), Expect = 1.7 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = +1 Query: 325 WNIMTKSNTRFSYPENTGIVI 387 W I+ TRF YP+ +++ Sbjct: 735 WMIIEPPGTRFFYPDRKQVIL 755 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 20.6 bits (41), Expect = 6.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 239 LKQSFFSIF*CSTYLMYVYNSICSSK 162 L+ SF + CST +YV + + SK Sbjct: 149 LRLSFCVVLACSTATVYVMSVVGLSK 174 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 20.2 bits (40), Expect = 9.2 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = -1 Query: 363 VRKSCIRFRHYIPSF 319 V +C+ F+H++ SF Sbjct: 273 VGPACLPFQHFLDSF 287 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,817 Number of Sequences: 438 Number of extensions: 2376 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10008927 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -