BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00287 (727 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0900 + 7091970-7092068,7092175-7093131,7093210-7093968,709... 29 3.8 01_03_0264 - 14419381-14419431,14419807-14419875,14420771-144208... 28 8.7 >01_01_0900 + 7091970-7092068,7092175-7093131,7093210-7093968, 7094322-7094366 Length = 619 Score = 29.1 bits (62), Expect = 3.8 Identities = 15/52 (28%), Positives = 23/52 (44%) Frame = +2 Query: 254 VVSSLFRASRQSTAISTFARYNHEQKNPMIKTWNIMTKSNTRFSYPENTDIV 409 ++++L A R A +TF R H P T+N + K PE + V Sbjct: 155 LINALVEARRMGEATNTFLRMGHSGCRPTASTFNTLIKGYGIAGRPEESQRV 206 >01_03_0264 - 14419381-14419431,14419807-14419875,14420771-14420817, 14421340-14422474 Length = 433 Score = 27.9 bits (59), Expect = 8.7 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +1 Query: 562 LPENLFLSQFSAFFLRNIREHLGEDINVEYCPTGSLVLASND 687 +P LFL + A FL N R G + +VLA+ND Sbjct: 202 IPPELFLRPYDAIFLNNNRFTSGIPDTIGRSTASVIVLANND 243 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,722,034 Number of Sequences: 37544 Number of extensions: 277651 Number of successful extensions: 556 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 550 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 556 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1898162308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -