BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00287 (727 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58214| Best HMM Match : DAO (HMM E-Value=0.00017) 31 1.3 SB_22902| Best HMM Match : Arm (HMM E-Value=0.41) 28 6.7 SB_2014| Best HMM Match : MAM (HMM E-Value=0) 28 8.9 >SB_58214| Best HMM Match : DAO (HMM E-Value=0.00017) Length = 280 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +1 Query: 529 LQHGTLSQHFTLPENLFLSQFSAFFLRNIREHLGED 636 L G + Q F++ EN+ LSQ+S F + +HL D Sbjct: 146 LSVGGIRQQFSMAENIQLSQYSYKFFTEVSKHLTVD 181 >SB_22902| Best HMM Match : Arm (HMM E-Value=0.41) Length = 147 Score = 28.3 bits (60), Expect = 6.7 Identities = 19/40 (47%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = +2 Query: 434 AATAYWLKRRAGDGLSVVV--IEKDFSINKLKGTFSMEHF 547 AA A +LK DGLSV++ + D KLK TF M HF Sbjct: 8 AAEAVFLKH---DGLSVLMRAMHSDTEKLKLKATFMMRHF 44 >SB_2014| Best HMM Match : MAM (HMM E-Value=0) Length = 2282 Score = 27.9 bits (59), Expect = 8.9 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 448 LVKAQSW*WSLSSGHRKRFFHKQAQRHLQHGTLSQHFTLP 567 ++K SW W + S ++ R+F + RH T+ H LP Sbjct: 806 ILKGGSWSWYIDSSNKIRYFDGNSDRH----TVVSHRLLP 841 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,989,027 Number of Sequences: 59808 Number of extensions: 348777 Number of successful extensions: 649 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 600 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 649 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -