BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00287 (727 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 23 2.2 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 23 3.9 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 23 3.9 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 22 5.1 AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc fi... 21 9.0 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 23.4 bits (48), Expect = 2.2 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -2 Query: 225 YLMYVYNSICSSKECIFG*TFLYVPSIWKLTI 130 Y + +YN+ S + + TF+Y P K TI Sbjct: 208 YALIIYNNADDSFQRLTSSTFVYDPRYTKYTI 239 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 22.6 bits (46), Expect = 3.9 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = +2 Query: 350 WNIMTKSNTRFSYPENTDIV 409 W I+ TRF YP+ ++ Sbjct: 645 WMIIEPPGTRFFYPDRKQVI 664 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 22.6 bits (46), Expect = 3.9 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = +2 Query: 350 WNIMTKSNTRFSYPENTDIV 409 W I+ TRF YP+ ++ Sbjct: 735 WMIIEPPGTRFFYPDRKQVI 754 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 22.2 bits (45), Expect = 5.1 Identities = 7/29 (24%), Positives = 16/29 (55%) Frame = +2 Query: 509 INKLKGTFSMEHFHNISHYQKICSYRNSV 595 I+ L + +++N ++Y K Y+N + Sbjct: 82 ISSLSNNYKYSNYNNYNNYNKKLYYKNYI 110 >AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc finger domain-Z1 isoform protein. Length = 111 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = +2 Query: 536 MEHFHNISHYQKICSYRNSVHSSLETLEN 622 +++ H + IC+ V+SSL +L N Sbjct: 22 IQNVHTRPSKEPICNICKRVYSSLNSLRN 50 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,046 Number of Sequences: 438 Number of extensions: 3732 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -