BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00283 (773 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0105 + 16693771-16693780,16693833-16693876,16694274-166943... 30 2.3 06_01_0081 + 646100-646346,646432-646848,647067-647170,648152-64... 29 3.1 07_03_0845 - 21979581-21981281 29 4.1 08_02_1080 - 24197514-24199415 29 5.4 05_01_0093 - 617515-619260 28 7.2 03_01_0130 - 1007433-1007712,1007739-1007803,1007804-1008001,100... 28 7.2 01_07_0150 + 41508546-41508636,41509384-41510343,41511082-415115... 28 9.5 >06_03_0105 + 16693771-16693780,16693833-16693876,16694274-16694348, 16694548-16694784,16694880-16695050,16695137-16695250 Length = 216 Score = 29.9 bits (64), Expect = 2.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 62 NWKCRCRPQTRRGSCWVF 9 N+ CRCRP+ RR W + Sbjct: 5 NYVCRCRPENRRNKGWAY 22 >06_01_0081 + 646100-646346,646432-646848,647067-647170,648152-648352, 649088-649798,649944-650674,650942-651017,651096-651182, 651429-651517,651917-651973,652402-652510,652590-652649, 652835-652919,653178-653242,653694-653753,653869-653913, 654697-654800,654877-655099 Length = 1156 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/24 (50%), Positives = 17/24 (70%), Gaps = 2/24 (8%) Frame = -2 Query: 181 SVCNDVA--FGRVDNPGDVCSAPL 116 S+CND+ F +D PGD+ S+PL Sbjct: 1111 SICNDLVQGFAAIDLPGDIFSSPL 1134 >07_03_0845 - 21979581-21981281 Length = 566 Score = 29.1 bits (62), Expect = 4.1 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 8/53 (15%) Frame = +2 Query: 593 QALKLDANVGEYNDRLTWGDGKDYT----SHHVSW----QLISLWEDNNVIFK 727 Q ++ GEY DR++W D +D S+HV Q +SLW + V ++ Sbjct: 167 QRFGINKITGEYQDRVSWKDPEDPAPGPFSNHVDLIRLNQYVSLWNQSKVYWQ 219 >08_02_1080 - 24197514-24199415 Length = 633 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +3 Query: 465 NAMSFAYKLWHEGHKTSSKITSRANSNSYSTN 560 N +SF+ + +K+TS+ NSNSYS N Sbjct: 540 NELSFSGRRKSHSGVAKNKVTSKINSNSYSGN 571 >05_01_0093 - 617515-619260 Length = 581 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +2 Query: 80 VKTVTISTGPITKRCAADVARIVNASEGYVVA 175 V T+T + P T CAA ++R ++ + YVVA Sbjct: 52 VVTLTAHSRPYTAACAASLSRRLSRTRDYVVA 83 >03_01_0130 - 1007433-1007712,1007739-1007803,1007804-1008001, 1008103-1008273,1008405-1008553,1008780-1008927, 1009015-1009083,1009168-1009416,1009516-1009710, 1009869-1009985,1010205-1011329 Length = 921 Score = 28.3 bits (60), Expect = 7.2 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +2 Query: 587 YNQALKLDANVGEYNDRLTWGDGKDYTSHHVSWQLISLWEDN 712 Y A L A G+ ND L + D+T + W +SLW ++ Sbjct: 795 YTWANMLSAPRGQVNDPLITQNSTDFTVALMDWFWMSLWAEH 836 >01_07_0150 + 41508546-41508636,41509384-41510343,41511082-41511555, 41511642-41511736 Length = 539 Score = 27.9 bits (59), Expect = 9.5 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +2 Query: 695 SLWEDNNVIFKILNTEYEM 751 ++W DN V + +LN EYE+ Sbjct: 250 TVWTDNKVCYNVLNGEYEI 268 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,249,899 Number of Sequences: 37544 Number of extensions: 377526 Number of successful extensions: 1234 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1198 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1234 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2068401984 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -