BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00282 (408 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1580 - 34576595-34576723,34576905-34576981,34577058-345771... 36 0.009 05_03_0664 - 16762121-16762637,16762704-16763331,16763418-16763637 29 1.9 05_01_0160 + 1081416-1081647,1081840-1082012,1082169-1082246,108... 28 3.3 08_02_1334 - 26224546-26225337 27 5.7 05_04_0355 - 20577189-20577275,20578001-20578129,20578252-205783... 27 5.7 06_03_0912 + 25896152-25896451,25896528-25897296,25897492-258976... 27 7.6 06_01_0810 + 6111962-6112507 27 7.6 >04_04_1580 - 34576595-34576723,34576905-34576981,34577058-34577104, 34577864-34577964,34578114-34578203,34578647-34578763, 34578835-34578992,34579562-34579843,34580367-34580667 Length = 433 Score = 36.3 bits (80), Expect = 0.009 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = +2 Query: 71 HTFVGTSVNRPLVYHH-DVQYSSKMFRKRVENLHFSLPHVPSIF 199 +T V TS PL +HH +Q S + F+ RV + + + PH+PS F Sbjct: 78 YTMVPTSAMLPLQHHHRQLQISQENFQDRVPSNNVAAPHLPSNF 121 >05_03_0664 - 16762121-16762637,16762704-16763331,16763418-16763637 Length = 454 Score = 28.7 bits (61), Expect = 1.9 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = -3 Query: 196 YGRYMRQAEMEVFNSLTEHFRAVLHVMVVDQGPIDAGADESVTAF 62 +GR+ A++ VFN+ + L +++ GP DAG + S T + Sbjct: 256 HGRHWEGADVIVFNTYL-WWCTGLQFRILEDGPFDAGGNSSTTTW 299 >05_01_0160 + 1081416-1081647,1081840-1082012,1082169-1082246, 1082372-1082529,1082558-1082709,1083232-1083290, 1083633-1083912,1084235-1084470,1084601-1084744, 1084845-1085012 Length = 559 Score = 27.9 bits (59), Expect = 3.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 10 HDEVANRCVATRRCGDRGMRSHFRRHQR 93 H++ +R V CG + ++ +F+RHQR Sbjct: 405 HNKSCHRHVVCDVCGTKQLKKNFKRHQR 432 >08_02_1334 - 26224546-26225337 Length = 263 Score = 27.1 bits (57), Expect = 5.7 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +3 Query: 66 AVTLSSAPASIGPWSTTMTCSTARKCSVREL 158 +VTL+ A++GP T + A C++R+L Sbjct: 9 SVTLADQLAAVGPAGTAAATAAAGSCNLRDL 39 >05_04_0355 - 20577189-20577275,20578001-20578129,20578252-20578371, 20578505-20578741,20578983-20579258,20579375-20579508, 20580006-20581632 Length = 869 Score = 27.1 bits (57), Expect = 5.7 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +2 Query: 68 GHTFVGTSVNRPLVYHHDVQYSSKMFRKRVENLHFSLPHVP 190 G VG S NR + +H + S + K+++NL L H+P Sbjct: 829 GRLIVGLS-NREIKKNHGICSSIPFYFKKIDNLIVILDHLP 868 >06_03_0912 + 25896152-25896451,25896528-25897296,25897492-25897658, 25898932-25901013,25901155-25901730,25904503-25905648, 25907056-25908693 Length = 2225 Score = 26.6 bits (56), Expect = 7.6 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +2 Query: 89 SVNRPLVYHHDVQYSSKMFRKRVENLHFSLPHVPSI 196 S N PL+Y H SS + K +ENL SL V + Sbjct: 1315 SSNIPLLYKHYDGQSSSLVIKNLENLKGSLGEVQEL 1350 >06_01_0810 + 6111962-6112507 Length = 181 Score = 26.6 bits (56), Expect = 7.6 Identities = 28/91 (30%), Positives = 33/91 (36%), Gaps = 5/91 (5%) Frame = -3 Query: 259 CSRSSAIGLVEGQNALNGPP-----EYGRYMRQAEMEVFNSLTEHFRAVLHVMVVDQGPI 95 CS S+ G +A PP G MRQ E T VL D+ + Sbjct: 64 CS-STGEGSYSAASATQAPPVGRRARLGMLMRQEEQR---ETTATAATVLGAAGHDKKEV 119 Query: 94 DAGADESVTAFHDHRSGE*QHNDLQLHHGKW 2 +E TA RSG QLHHG W Sbjct: 120 PPAEEEKKTA---RRSGFWARLQQQLHHGSW 147 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,390,380 Number of Sequences: 37544 Number of extensions: 245674 Number of successful extensions: 638 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 626 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 638 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 718652880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -