BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS00282 (408 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49021| Best HMM Match : WAP (HMM E-Value=7.2) 32 0.16 SB_44732| Best HMM Match : TSP_1 (HMM E-Value=0) 31 0.36 SB_14885| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.1 SB_40691| Best HMM Match : Peptidase_C27 (HMM E-Value=1.1) 29 1.5 SB_3851| Best HMM Match : TSP_1 (HMM E-Value=3.7e-24) 29 1.5 SB_45543| Best HMM Match : PP2C (HMM E-Value=6.00036e-42) 27 4.5 SB_16861| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.5 SB_15525| Best HMM Match : Galactosyl_T (HMM E-Value=1.1e-31) 27 5.9 SB_10010| Best HMM Match : HLH (HMM E-Value=8.5e-09) 27 5.9 SB_7689| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 SB_55365| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 SB_8484| Best HMM Match : Heme_oxygenase (HMM E-Value=0) 27 7.8 >SB_49021| Best HMM Match : WAP (HMM E-Value=7.2) Length = 158 Score = 32.3 bits (70), Expect = 0.16 Identities = 19/71 (26%), Positives = 31/71 (43%), Gaps = 6/71 (8%) Frame = +3 Query: 21 CKSLCCY--SPLR*SWNAVTLSSAPASIGPWSTTMTCSTARKCSVRELKTSISACLMY-- 188 C+ L CY +P +W L + G WS C ++CS R+ + CL++ Sbjct: 41 CRKLKCYDINPYVINWIVSFLGNRKKGCGGWSVNEVCRDRQRCSSRD---CVGTCLVFNY 97 Query: 189 --LPYSGGPFR 215 Y G P++ Sbjct: 98 GERHYPGQPYK 108 >SB_44732| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 675 Score = 31.1 bits (67), Expect = 0.36 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -2 Query: 239 RSCRRPECPEWTSRIWKVHEAS*NGGFQLSYGTFSS 132 R C+ P CPEWT W + GG T SS Sbjct: 254 RKCQLPACPEWTVGKWSECSRTCGGGISARTVTCSS 289 Score = 26.6 bits (56), Expect = 7.8 Identities = 21/61 (34%), Positives = 25/61 (40%), Gaps = 3/61 (4%) Frame = -2 Query: 239 RSCRRPECPEWTSRIWKVHEAS*NGGFQLS--YGTFSSCTARHGGRPRAY*RWCR-RKCD 69 R C ECP W S W+ + GFQ Y T SS +P + R C R C Sbjct: 404 RVCALGECPTWKSGPWEKCSKTCGVGFQARSVYCTASSVDKCDEKKPSSR-RQCNIRPCP 462 Query: 68 R 66 R Sbjct: 463 R 463 >SB_14885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 472 Score = 29.5 bits (63), Expect = 1.1 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 4/41 (9%) Frame = +1 Query: 121 RAVQLENVP*--ES*KPPFQLAS--CTFHIREVHSGHSGLR 231 R V ENVP ++ KPPF+ + CT +R G+SGL+ Sbjct: 39 REVAKENVPLPNKAEKPPFESGTFTCTLRMRGARGGYSGLK 79 >SB_40691| Best HMM Match : Peptidase_C27 (HMM E-Value=1.1) Length = 406 Score = 29.1 bits (62), Expect = 1.5 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 7/65 (10%) Frame = -2 Query: 194 WKVHEAS*NGGFQLSYGTFSSCTARHGGRPRAY*RWCRRKCDRI------PRSPQ-RRVA 36 +KV+ + GG L FSSCT+ +P Y KC + P SP R+V+ Sbjct: 224 FKVYRKNLTGGVGLEIKVFSSCTSILNSKPNPYREKTVEKCCKTTRGQVDPSSPDARKVS 283 Query: 35 TQRFA 21 +R A Sbjct: 284 LRRVA 288 >SB_3851| Best HMM Match : TSP_1 (HMM E-Value=3.7e-24) Length = 429 Score = 29.1 bits (62), Expect = 1.5 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = -2 Query: 233 CRRPECPEWTSRIWKVHEAS*NGGFQLSYGTFSSCTARHG 114 C + ECP WT+ W ++ G + F SC R G Sbjct: 49 CEKGECPRWTAGAWSECSSTCGSGVRT---RFVSCKPRDG 85 >SB_45543| Best HMM Match : PP2C (HMM E-Value=6.00036e-42) Length = 375 Score = 27.5 bits (58), Expect = 4.5 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 128 YSSKMFRKRVENLHFSLPHVPSIFG 202 Y+ K R+++E+ H +PH S+FG Sbjct: 44 YAIKNTRRKMEDKHVIMPHFNSLFG 68 >SB_16861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2214 Score = 27.5 bits (58), Expect = 4.5 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = -2 Query: 155 LSYGTFSSCT-ARHGGRPRAY*RWCRRKCDRIPRSPQRRVATQRFATSSWQ 6 LSYG +S A H R R RW RR+ + P S +++ Q+ W+ Sbjct: 1032 LSYGVYSPVQKAYHLSRRR---RWVRRRDLKHPESTKKQEHFQKLLLEGWE 1079 >SB_15525| Best HMM Match : Galactosyl_T (HMM E-Value=1.1e-31) Length = 522 Score = 27.1 bits (57), Expect = 5.9 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 183 MYLPYSGGPFRAFWPSTRPIALLLEHH 263 +Y PY GGPF F + P + L +H Sbjct: 350 VYPPYCGGPFYVFTSNLLPDFIRLTYH 376 >SB_10010| Best HMM Match : HLH (HMM E-Value=8.5e-09) Length = 227 Score = 27.1 bits (57), Expect = 5.9 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 138 KCSVRELKTSISACLMYLPYSGGP 209 K ++EL TSI+ C LP +G P Sbjct: 97 KKEIQELNTSINTCQSQLPATGAP 120 >SB_7689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 612 Score = 27.1 bits (57), Expect = 5.9 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +3 Query: 78 SSAPASIGPWSTTMTCSTARKCSVRELKTSISACLMYLPYSG 203 S P + P+S T A C + L T++ AC + LPY G Sbjct: 517 SLRPFKLAPFSPLTTALQA--CYLLFLTTTLQACPLLLPYYG 556 >SB_55365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 26.6 bits (56), Expect = 7.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 309 RARIKNSLRCIHFCLIIASAINR 377 RAR+K RC H CL S + R Sbjct: 58 RARVKERKRCGHNCLTTTSEVGR 80 >SB_8484| Best HMM Match : Heme_oxygenase (HMM E-Value=0) Length = 820 Score = 26.6 bits (56), Expect = 7.8 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = +3 Query: 150 RELKTSISACLMYLPYSGGPFRAFWPSTRPIALLLEHH 263 +E+K + C ++ G PF+ RP+ LE H Sbjct: 451 KEIKEEMGECPVFATDDGCPFKTICSDGRPLVEKLEFH 488 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,974,714 Number of Sequences: 59808 Number of extensions: 270089 Number of successful extensions: 647 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 647 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 740151420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -